KEGG   Homo sapiens (human): 51292
Entry
51292             CDS       T01001                                 

Gene name
GMPR2, GMPR_2
Definition
(RefSeq) guanosine monophosphate reductase 2
  KO
K00364  GMP reductase [EC:1.7.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    51292 (GMPR2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     51292 (GMPR2)
SSDB
Motif
Pfam: IMPDH FMN_dh Aldolase Glu_synthase QRPTase_C dCache_3
Other DBs
NCBI-GeneID: 51292
NCBI-ProteinID: NP_001002000
OMIM: 610781
HGNC: 4377
Ensembl: ENSG00000100938
Vega: OTTHUMG00000171912
Pharos: Q9P2T1(Tbio)
UniProt: Q9P2T1
Structure
PDB: 
2C6Q 2BZN 2A7R

Position
14q12
AA seq 348 aa
MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGT
FEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAI
PQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGI
GPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVM
LGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGD
VEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgcctcatattgacaacgatgtgaaactggacttcaaggatgtccttttgaggcccaaa
cgcagtacccttaagtctcgaagtgaggtggatctcacaagatccttttcatttcggaac
tcaaagcagacatactctggggttcccatcattgctgccaatatggatactgtgggcacc
tttgagatggccaaggttctctgtaagttctctctcttcactgctgtccataagcactat
agcctcgttcagtggcaagagtttgctggccagaatcctgactgtcttgagcatctggct
gccagctcaggcacaggctcttctgactttgagcagctggaacagatcctggaagctatt
ccccaggtgaagtatatatgcctggatgtggcaaatggctactctgaacactttgttgaa
tttgtaaaagatgtacggaagcgcttcccccagcacaccatcatggcagggaatgtggta
acaggagagatggtagaagagctcatcctttctggggctgacatcatcaaagtgggaatt
gggccaggctctgtgtgtactactcggaagaaaactggagtggggtatccacagctcagc
gcagtgatggagtgtgcagatgctgctcatggcctcaaaggccacatcatttcagatgga
ggttgcagctgtcctggggatgtggccaaggcttttggggcaggagctgacttcgtgatg
ctgggtggcatgctggctgggcacagtgagtcaggtggtgagctcatcgagagggatggc
aagaagtacaagctcttctatggaatgagttctgaaatggccatgaagaagtatgctggg
ggcgtggctgagtacagagcctcagagggaaagacagtggaagttccttttaaaggagat
gtggaacataccatccgagacatcctaggagggatccgctctacgtgtacctatgtggga
gcagctaagctcaaagagttgagcaggagaactaccttcatccgagtcacccagcaggtg
aatccaatcttcagtgaggcgtgctag

DBGET integrated database retrieval system