KEGG   Homo sapiens (human): 51296Help
Entry
51296             CDS       T01001                                 

Gene name
SLC15A3, OCTP, PHT2, PTR3
Definition
(RefSeq) solute carrier family 15 member 3
  KO
K14638  solute carrier family 15 (peptide/histidine transporter), member 3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    51296 (SLC15A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC15: Proton oligopeptide cotransporter
   51296 (SLC15A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-GeneID: 51296
NCBI-ProteinID: NP_057666
OMIM: 610408
HGNC: 18068
Ensembl: ENSG00000110446
Vega: OTTHUMG00000167804
Pharos: Q8IY34(Tdark)
UniProt: Q8IY34
Position
11q12.2
AA seq 581 aa AA seqDB search
MPAPRAREQPRVPGERQPLLPRGARGPRRWRRAAGAAVLLVEMLERAAFFGVTANLVLYL
NSTNFNWTGEQATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPA
TAFPDGRSSFCGEMPASPLGPACPSAGCPRSSPSPYCAPVLYAGLLLLGLAASSVRSNLT
SFGADQVMDLGRDATRRFFNWFYWSINLGAVLSLLVVAFIQQNISFLLGYSIPVGCVGLA
FFIFLFATPVFITKPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPG
ASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFPANPANISVA
LRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFT
SVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGL
EFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDL
YFFLLAGIQAVTALLFVWIAGRYERASQGPASHSRFSRDRG
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgccgcgcgcccgggagcagccccgcgtgcccggggagcgccagccgctgctg
cctcgcggtgcgcggggccctcgacggtggcggcgggcggcgggcgcggccgtgctgctg
gtggagatgctggagcgcgccgccttcttcggcgtcaccgccaacctcgtgctgtacctc
aacagcaccaacttcaactggaccggcgagcaggcgacgcgcgccgcgctggtattcctg
ggcgcctcctacctgctggcgcccgtgggcggctggctggccgacgtgtacctgggccgc
taccgcgcggtcgcgctcagcctgctgctctacctggccgcctcgggcctgctgcccgcc
accgccttccccgacggccgcagctccttctgcggagagatgcccgcgtcgccgctggga
cctgcctgcccctcggccggctgcccgcgctcctcgcccagcccctactgcgcgcccgtc
ctctacgcgggcctgctgctactcggcctggccgccagctccgtccggagcaacctcacc
tccttcggtgccgaccaggtgatggatctcggccgcgacgccacccgccgcttcttcaac
tggttttactggagcatcaacctgggtgctgtgctgtcgctgctggtggtggcgtttatt
cagcagaacatcagcttcctgctgggctacagcatccctgtgggctgtgtgggcctggca
tttttcatcttcctctttgccacccccgtcttcatcaccaagcccccgatgggcagccaa
gtgtcctctatgcttaagctcgctctccaaaactgctgcccccagctgtggcaacgacac
tcggccagagaccgtcaatgtgcccgcgtgctggccgacgagaggtctccccagccaggg
gcttccccgcaagaggacatcgccaacttccaggtgctggtgaagatcttgcccgtcatg
gtgaccctggtgccctactggatggtctacttccagatgcagtccacctatgtcctgcag
ggtcttcacctccacatcccaaacattttcccagccaacccggccaacatctctgtggcc
ctgagagcccagggcagcagctacacgatcccggaagcctggctcctcctggccaatgtt
gtggtggtgctgattctggtccctctgaaggaccgcttgatcgaccctttactgctgcgg
tgcaagctgcttccctctgctctgcagaagatggcgctggggatgttctttggttttacc
tccgtcattgtggcaggagtcctggagatggagcgcttacactacatccaccacaacgag
accgtgtcccagcagattggggaggtcctgtacaacgcggcaccactgtccatctggtgg
cagatccctcagtacctgctcattgggatcagtgagatctttgccagcatcccaggcctg
gagtttgcctactcagaggccccgcgctccatgcagggcgccatcatgggcatcttcttc
tgcctgtcgggggtgggctcactgttgggctccagcctagtggcactgctgtccttgccc
gggggctggctgcactgccccaaggactttgggaacatcaacaattgccggatggacctc
tacttcttcctgctggctggcattcaggccgtcacggctctcctatttgtctggatcgct
ggacgctatgagagggcgtcccagggcccagcctcccacagccgtttcagcagggacagg
ggctga

DBGET integrated database retrieval system