KEGG   Homo sapiens (human): 51300Help
Entry
51300             CDS       T01001                                 

Gene name
TIMMDC1, C3orf1
Definition
(RefSeq) translocase of inner mitochondrial membrane domain containing 1
Organism
hsa  Homo sapiens (human)
Disease
H00473  Mitochondrial complex I deficiency
SSDB OrthologParalogGFIT
Motif
Pfam: Tim17
Motif
Other DBs
NCBI-GeneID: 51300
NCBI-ProteinID: NP_057673
OMIM: 615534
HGNC: 1321
Ensembl: ENSG00000113845
Vega: OTTHUMG00000159388
Pharos: Q9NPL8(Tdark)
UniProt: Q9NPL8
Position
3q13.33
AA seq 285 aa AA seqDB search
MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRE
LFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAV
QSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFR
INVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRL
QVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgccgccaccggcaccgcggagctttctctgtagagcattgtgcctatttccc
cgagtctttgctgccgaagctgtgactgccgattcggaagtccttgaggagcgtcagaag
cggcttccctacgtcccagagccctattacccggaatctggatgggaccgcctccgggag
ctgtttggcaaagatgaacagcagagaatttcaaaggaccttgctaatatctgtaagacg
gcagctacagcaggcatcattggctgggtgtatgggggaataccagcttttattcatgct
aaacaacaatacattgagcagagccaggcagaaatttatcataaccggtttgatgctgtg
caatctgcacatcgtgctgccacacgaggcttcattcgttatggctggcgctggggttgg
agaactgcagtgtttgtgactatattcaacacagtgaacactagtctgaatgtataccga
aataaagatgccttaagccattttgtaattgcaggagctgtcacgggaagtctttttagg
ataaacgtaggcctgcgtggcctggtggctggtggcataattggagccttgctgggcact
cctgtaggaggcctgctgatggcatttcagaagtactctggtgagactgttcaggaaaga
aaacagaaggatcgaaaggcactccatgagctaaaactggaagagtggaaaggcagacta
caagttactgagcacctccctgagaaaattgaaagtagtttacaggaagatgaacctgag
aatgatgctaagaaaattgaagcactgctaaaccttcctagaaacccttcagtaatagat
aaacaagacaaggactga

DBGET integrated database retrieval system