KEGG   Homo sapiens (human): 51303
Entry
51303             CDS       T01001                                 
Symbol
FKBP11, FKBP19
Name
(RefSeq) FKBP prolyl isomerase 11
  KO
K09576  FK506-binding protein 11 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    51303 (FKBP11)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     51303 (FKBP11)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    51303 (FKBP11)
SSDB
Motif
Pfam: FKBP_C DUF6190
Other DBs
NCBI-GeneID: 51303
NCBI-ProteinID: NP_057678
OMIM: 610571
HGNC: 18624
Ensembl: ENSG00000134285
Pharos: Q9NYL4(Tdark)
UniProt: Q9NYL4
Position
12:complement(48921963..48939034)
AA seq 201 aa
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTL
HIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYG
KRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKA
NRPKVSKKKLKEEKRNKSKKK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaccctgcgcccctcactcctcccgctccatctgctgctgctgctgctgctcagtgcg
gcggtgtgccgggctgaggctgggctcgaaaccgaaagtcccgtccggaccctccaagtg
gagaccctggtggagcccccagaaccatgtgccgagcccgctgcttttggagacacgctt
cacatacactacacgggaagcttggtagatggacgtattattgacacctccctgaccaga
gaccctctggttatagaacttggccaaaagcaggtgattccaggtctggagcagagtctt
ctcgacatgtgtgtgggagagaagcgaagggcaatcattccttctcacttggcctatgga
aaacggggatttccaccatctgtcccagcggatgcagtggtgcagtatgacgtggagctg
attgcactaatccgagccaactactggctaaagctggtgaagggcattttgcctctggta
gggatggccatggtgccagccctcctgggcctcattgggtatcacctatacagaaaggcc
aatagacccaaagtctccaaaaagaagctcaaggaagagaaacgaaacaagagcaaaaag
aaataa

DBGET integrated database retrieval system