KEGG   Homo sapiens (human): 51305Help
Entry
51305             CDS       T01001                                 

Gene name
KCNK9, K2p9.1, KT3.2, TASK-3, TASK3
Definition
(RefSeq) potassium two pore domain channel subfamily K member 9
  KO
K04919  potassium channel subfamily K member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04925  Aldosterone synthesis and secretion
Disease
H00709  Birk Barel mental retardation syndrome (BBMRS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    51305 (KCNK9)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (KCNK)
   51305 (KCNK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 Ion_trans
Motif
Other DBs
NCBI-GeneID: 51305
NCBI-ProteinID: NP_001269463
OMIM: 605874
HGNC: 6283
Ensembl: ENSG00000169427
Vega: OTTHUMG00000164186
Pharos: Q9NPC2(Tclin)
UniProt: Q9NPC2 A0A024R9H3
Position
8q24.3
AA seq 374 aa AA seqDB search
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ
CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN
LVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT
CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHS
FTDHQRLMKRRKSV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggcagaacgtgcggactctgtccctcatcgtctgcaccttcacctacctgctg
gtgggcgccgccgtgttcgacgccctcgagtcggaccacgagatgcgcgaggaggagaaa
ctcaaagccgaggagatccggatcaaggggaagtacaacatcagcagcgaggactaccgg
cagctggagctggtgatcctgcagtcggaaccgcaccgcgccggcgtccagtggaaattc
gccggctccttctactttgcgatcacggtcatcaccaccataggttatgggcacgctgca
cctggcaccgatgcgggcaaggccttctgcatgttctacgccgtgctgggcatcccgctg
acactggtcatgttccagagcctgggcgagcgcatgaacaccttcgtgcgctacctgctg
aagcgcattaagaagtgctgtggcatgcgcaacactgacgtgtctatggagaacatggtg
actgtgggcttcttctcctgcatggggacgctgtgcatcggggcggccgccttctcccag
tgtgaggagtggagcttcttccacgcctactactactgcttcatcacgttgactaccatt
gggttcggggactacgtggccctgcagaccaagggtgccctgcagaagaagccgctctac
gtggcctttagctttatgtatatcctggtggggctgacggtcatcggggccttcctcaac
ctggtcgtcctcaggttcttgaccatgaacagtgaggatgagcggcgggatgctgaagag
agggcatccctcgccggaaaccgcaacagcatggtcattcacatccctgaggagccgcgg
cccagccggcccaggtacaaggcggacgtcccggacctgcagtctgtgtgctcctgcacc
tgctaccgctcgcaggactatggcggccgctcggtggcaccgcagaactccttcagcgcc
aagcttgccccccactacttccactccatctcttacaagatcgaggagatctcaccaagc
acattaaaaaacagcctcttcccatcgcctattagctccatctctcctgggttacacagc
tttaccgaccaccagaggctgatgaaacgccggaagtccgtttag

DBGET integrated database retrieval system