KEGG   Homo sapiens (human): 51306
Entry
51306             CDS       T01001                                 
Symbol
FAM13B, ARHGAP49, C5orf5, FAM13B1, KHCHP, N61
Name
(RefSeq) family with sequence similarity 13 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: RhoGAP Drc1-Sld2 MazG
Other DBs
NCBI-GeneID: 51306
NCBI-ProteinID: NP_057687
OMIM: 609371
HGNC: 1335
Ensembl: ENSG00000031003
Pharos: Q9NYF5(Tbio)
UniProt: Q9NYF5 A0A2X0SG06
Position
5:complement(137937960..138052178)
AA seq 915 aa
MRKSSSPSLSNCNSVLANKIFGIPLDELQQGGHPDNEVPFIVRHVVDYIEEHGGLEQQGL
FQVNGNAETVEWLRQRYDSGEEVDLVKEADVPSAISLLRFFLQELPEPVIPGSLHIHLMQ
LSQDYNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASHHEEIWSANSLAAVFGPD
VFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSITEQVNELSEEEEE
DEKLEHIEELPEEGAEKSNDMPEVVQLRMTENILESNSVTATSTHISPISILPASTDILE
RTIRAAVEQHLFDLQSSIDHDLKNLQQQSVVCNNEAESIHCDGEGSNNQIDIADDIINAS
ESNRDCSKPVASTNLDNEAMQQDCVFENEENTQSVGILLEPCSDRGDSEDGCLEREEYLL
FDSDKLSHLILDSSSKICDLNANTESEVPGGQSVGVQGEAACVSIPHLDLKNVSDGDKWE
EPFPAFKSWQEDSESGEAQLSPQAGRMNHHPLEEDCPPVLSHRSLDFGQSQRFLHDPEKL
DSSSKALSFTRIRRSSFSSKDEKREDRTPYQLVKKLQKKIRQFEEQFERERNSKPSYSDI
AANPKVLKWMTELTKLRKQIKDAKHKNSDGEFVPQTRPRSNTLPKSFGSSLDHEDEENED
EPKVIQKEKKPSKEATLELILKRLKEKRIERCLPEDIKKMTKDHLVEEKASLQKSLLYYE
SQHGRPVTKEERHIVKPLYDRYRLVKQMLTRASITPVLGSPSTKRRGQMLQPIIEGETAH
FFEEIKEEEEDGVNLSSELGDMLKTAVQVQSSLENSESDVEENQEKLALDLRLSSSRAAS
MPELLEQLWKARAEKKKLRKTLREFEEAFYQQNGRNAQKEDRVPVLEEYREYKKIKAKLR
LLEVLISKQDSSKSI
NT seq 2748 nt   +upstreamnt  +downstreamnt
atgaggaagagctcctccccttccttgagtaactgcaactccgttcttgctaacaaaata
tttggaattccacttgatgagctgcagcagggaggacatccagacaatgaggttccattc
atagtccgccacgttgtggactatattgaggaacatggaggtctggagcaacaaggactt
tttcaagtcaatggaaatgctgagacagtggagtggcttcggcagagatacgacagcgga
gaagaggtggatttggttaaggaagcagatgttccctcagctattagccttcttagattt
tttcttcaagaacttcctgaacctgttatccctggcagtttacatattcacttgatgcag
ctttctcaagattataataatgaagatgaatttggaagaaagttgaggttcctcttgcaa
cagcttccacctgttaattatagtttgttaaagtttctgtgtagatttttagccaatgta
gcatcacatcatgaagaaatttggtccgcaaattctttggctgctgtctttggtccagat
gtcttccacatttacacagatgtggaagacatgaaagagcaagaaatagtgagcaggata
atggctggacttctggaaaactactatgagttttttgagaatgaagaggaagatttttca
tctaatgatttgagttcaattactgaacaggttaatgaactttctgaggaagaagaggaa
gatgaaaagctggaacatattgaagaacttccagaagagggtgcagaaaaatcaaatgac
atgccagaggtggtacaattaaggatgactgaaaacatcctggaatcaaatagtgttacg
gcaacaagcacccatatatctcccatcagcatcctaccagcctctacagatattttagaa
agaacaattagagcagctgtggaacagcacctttttgatcttcagagcagcatagatcat
gatcttaagaatttacaacagcaaagtgtggtgtgtaataatgaagcagaaagtattcat
tgtgatggggaaggatctaataaccagattgatattgctgatgatattattaatgccagt
gaaagtaacagagactgttcaaaacctgtggctagcactaatttagacaatgaagctatg
cagcaagattgtgtatttgagaatgaagaaaatacccagtctgtaggtatattgttagag
ccatgcagtgaccgtggtgatagtgaagatggctgtcttgagagggaagaatatttgtta
tttgacagtgataaattgtcacacttgattctggattctagtagcaagatatgtgatttg
aatgccaacactgaatcagaagtaccaggaggtcagagtgttggtgttcaaggggaagca
gcgtgtgtcagtattccacatttagatctgaagaatgtttctgatggtgataaatgggaa
gagccatttcctgcttttaagtcttggcaggaggactctgagtctggagaagctcagctg
tctccacaagctggaagaatgaatcatcaccccttggaagaggactgtcctccagtatta
tcacaccgcagtttagattttggtcaaagccagcgtttcctacatgatccagaaaagttg
gattcctcatctaaagcactgtcttttactagaattcgaagatcatcctttagttcaaaa
gatgaaaagagagaggacagaacaccttatcagctggtcaagaaacttcagaagaaaatc
agacaatttgaggaacagtttgaaagggaaagaaatagcaagccctcctacagtgatatt
gctgccaatccaaaggtattaaaatggatgacagagcttacaaaactgcggaagcaaatt
aaagatgcaaaacacaaaaattctgatggagaatttgtacctcagacacgtccacgtagt
aacacacttccaaaaagctttggctcttctctagaccatgaagatgaagagaatgaagat
gaacccaaggtcattcagaaggagaaaaaaccatctaaagaagcaacccttgaacttatt
cttaaaagactgaaagaaaaacgtattgagaggtgtcttccagaagatatcaagaaaatg
accaaagatcatttggtagaagagaaagcttctcttcagaaaagtcttctttactatgaa
agtcaacatggaaggccggtgaccaaggaagaaaggcacattgttaaacctctctatgat
agatacaggcttgtaaaacaaatgctgacaagagctagcatcactcctgtccttggatct
ccatccaccaagcgaaggggtcagatgttacagccaatcatagaaggagaaactgcacat
ttttttgaagaaatcaaggaggaagaagaagatggtgttaatctgtcctctgagttaggt
gatatgttgaaaactgcagtacaggtacagtcttcattagaaaactctgaatctgatgtt
gaagaaaatcaagaaaaactggctctggatctccgattgtcaagttctcgagcagcttct
atgcctgaattattggaacaactttggaaagccagagctgaaaaaaagaaactacgcaaa
acgttgcgggaatttgaagaagcattttatcaacaaaatggaaggaatgcccagaaagag
gatcgtgttccagtgcttgaggagtacagagagtacaagaaaattaaagccaagcttagg
cttcttgaagttcttataagcaaacaagattcttcaaaatccatataa

DBGET integrated database retrieval system