KEGG   Homo sapiens (human): 51312
Entry
51312             CDS       T01001                                 

Gene name
SLC25A37, HT015, MFRN, MFRN1, MSC, MSCP, PRO1278, PRO1584, PRO2217
Definition
(RefSeq) solute carrier family 25 member 37
  KO
K15113  solute carrier family 25 (mitochondrial iron transporter), member 28/37
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51312 (SLC25A37)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    51312 (SLC25A37)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    51312 (SLC25A37)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   51312 (SLC25A37)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 51312
NCBI-ProteinID: NP_057696
OMIM: 610387
HGNC: 29786
Ensembl: ENSG00000147454
Vega: OTTHUMG00000163865
Pharos: Q9NYZ2(Tbio)
UniProt: Q9NYZ2 Q71JB2
Position
8p21.2
AA seq 338 aa
MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEH
SVMYPVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAM
YFACYENMKRTLNDVFHHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRS
AISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPHRTYNPQSHIIS
GGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFK
GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggagctgcgcagcgggagcgtgggcagccaggcggtggcgcggaggatggatggggac
agccgagatggcggcggcggcaaggacgccaccgggtcggaggactacgagaacctgccg
actagcgcctccgtgtccacccacatgacagcaggagcgatggccgggatcctggagcac
tcggtcatgtacccggtggactcggtgaagacacgaatgcagagtttgagtccagatccc
aaagcccagtacacaagtatctacggagccctcaagaaaatcatgcggaccgaaggcttc
tggaggcccttgcgaggcgtcaacgtcatgatcatgggtgcagggccggcccatgccatg
tattttgcctgctatgaaaacatgaaaaggactttaaatgacgttttccaccaccaagga
aacagccacctagccaacgggatagctgggagtatggccaccctgctccacgatgcggta
atgaatccagcagaagtggtgaagcagcgcttgcagatgtacaactcgcagcaccggtca
gcaatcagctgcatccggacggtgtggaggaccgaggggttgggggccttctaccggagc
tacaccacgcagctgaccatgaacatccccttccagtccatccacttcatcacctatgag
ttcctgcaggagcaggtcaacccccaccggacctacaacccgcagtcccacatcatctca
ggcgggctggccggggccctcgccgcggccgccacgacccccctggacgtctgtaagacc
cttctgaacactcaggagaacgtggccctctcgctggccaacatcagcggccggctgtcg
ggtatggccaatgccttccggacggtgtaccagctcaacggcctggccggctacttcaaa
ggcatccaggcgcgtgtcatctaccagatgccctccaccgccatttcttggtctgtctat
gagttcttcaagtactttctcaccaagcgccagctggaaaatcgagctccatactaa

DBGET integrated database retrieval system