KEGG   Homo sapiens (human): 51314
Entry
51314             CDS       T01001                                 
Symbol
NME8, CILD6, DNAI8, HEL-S-99, NM23-H8, SPTRX2, TXNDC3, sptrx-2
Name
(RefSeq) NME/NM23 family member 8
  KO
K19868  thioredoxin domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Disease
H00564  Primary ciliary dyskinesia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    51314 (NME8)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Dynein assembly factors
   51314 (NME8)
SSDB
Motif
Pfam: NDK Thioredoxin Redoxin AhpC-TSA Nif11
Other DBs
NCBI-GeneID: 51314
NCBI-ProteinID: NP_057700
OMIM: 607421
HGNC: 16473
Ensembl: ENSG00000086288
UniProt: Q8N427
Position
7:37848597..37900397
AA seq 588 aa
MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDE
ILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKI
AAGEMARPQYPEIPLVDSDSEVSEESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKA
GFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSKHNPPSEET
EPQTDTEPNERSEDQPEVEAQVTPGMMKNKQDSLQEYLERQHLAQLCDIEEDAANVAKFM
DAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQA
LCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQ
FAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDL
TQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTD
PEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPEEN
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggcaagcaaaaaacgagaagtccagttacagacagtcatcaataatcaaagcctgtgg
gatgagatgttgcagaacaaaggcttaacagtgattgatgtttaccaagcctggtgtgga
ccttgcagagcaatgcaacctttattcagaaaattgaaaaatgaactgaacgaagacgaa
attctgcattttgctgtcgcagaagctgacaacattgtgactttgcagccatttagagat
aaatgtgaacctgtttttctctttagtgttaatggcaaaattatcgaaaagattcagggt
gcaaatgcaccgcttgttaataaaaaagttattaatttgatcgatgaggagagaaaaatt
gcagcaggtgaaatggctcgacctcagtatcctgaaattccattagtagactcagattca
gaagttagtgaagaatcaccatgtgaaagtgttcaggaattatacagtattgctattatc
aaaccggatgctgtgattagtaaaaaagttctagaaattaaaagaaaaattaccaaagct
ggatttattatagaagcagagcataagacagtgctcactgaagaacaagttgtcaacttc
tatagtcgaatagcagaccagtgtgacttcgaagagtttgtctcttttatgacaagtggc
ttaagctatattctagttgtatctcaaggaagtaaacacaatcctccctctgaagaaacc
gaaccacagactgacaccgaacctaacgaacgatctgaggatcaacctgaggtcgaagcc
caggttacacctggaatgatgaagaacaaacaagacagtttacaagaatatctggaaaga
caacatttagctcagctctgtgacattgaagaggatgcagctaatgttgctaagttcatg
gatgctttcttccccgattttaaaaaaatgaaaagcatgaaattagaaaagacattggca
ttacttcgaccaaatctctttcatgaaaggaaagatgatgttttgcgtattattaaagat
gaagacttcaaaatactggagcaaagacaagtagtattatcggaaaaagaagcacaagca
ctgtgcaaggaatatgaaaatgaagactattttaataaacttatagaaaacatgaccagt
ggtccatctctagcccttgttttattgagagacaatggcttgcaatactggaaacaatta
ctgggaccaagaactgttgaagaagccattgaatattttccagagagtttatgtgcacag
tttgcgatggacagtttgccggtcaaccagttgtatggcagcgattcattagaaaccgct
gaaagggaaatacagcatttctttcctcttcaaagcactttaggcttgattaaacctcat
gcaacaagtgaacaaagagagcagatcctgaagatagttaaggaggctggatttgatctg
acacaggtgaagaaaatgttcctaactcctgagcaaatagagaaaatttatccaaaagta
acaggaaaagacttttataaagatttattggaaatgttatctgtgggtccatctatggtc
atgattctgaccaagtggaatgctgttgcagaatggagacgattgatgggcccaacagac
ccagaagaagcaaaattactttcccctgactccatccgagcccagtttggaataagtaaa
ttgaaaaacattgtccatggagcatctaacgcctatgaagcaaaagaggttgttaataga
ctctttgaggatcctgaggaaaactaa

DBGET integrated database retrieval system