KEGG   Homo sapiens (human): 51317
Entry
51317             CDS       T01001                                 
Symbol
PHF21A, BHC80, BM-006, IDDBCS, NEDMS
Name
(RefSeq) PHD finger protein 21A
  KO
K24651  PHD finger protein 21A
Organism
hsa  Homo sapiens (human)
Disease
H02463  Syndromic intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    51317 (PHF21A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    BRAF-HDAC complex
     51317 (PHF21A)
SSDB
Motif
Pfam: PHD zf-HC5HC2H DUF1043 C1_1 PHD_2 AT_hook DUF6026 C1_2 zf-RING_15
Other DBs
NCBI-GeneID: 51317
NCBI-ProteinID: NP_001095272
OMIM: 608325
HGNC: 24156
Ensembl: ENSG00000135365
Vega: OTTHUMG00000167038
Pharos: Q96BD5(Tbio)
UniProt: Q96BD5
Structure
Position
11:complement(45929319..46121454)
AA seq 680 aa
MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEKQKRVVEQLRK
NLIVKQEQPDKFQIQPLPQSENKLQTAQQQPLQQLQQQQQYHHHHAQQSAAASPNLTASQ
KTVTTASMITTKTLPLVLKAATATMPASVVGQRPTIAMVTAINSQKAVLSTDVQNTPVNL
QTSSKVTGPGAEAVQIVAKNTVTLVQATPPQPIKVPQFIPPPRLTPRPNFLPQVRPKPVA
QNNIPIAPAPPPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPM
AQLTSIVIATPGTRLAGPQTVQLSKPSLEKQTVKSHTETDEKQTESRTITPPAAPKPKRE
ENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNST
MHPGTRKRGRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPT
STDGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKE
EAIPWPGTLAIVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEM
KNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTP
APSPSSQSCTANCNQGEETK
NT seq 2043 nt   +upstreamnt  +downstreamnt
atggagttgcagactctacaggaggctcttaaagtggaaattcaggttcaccagaaactg
gttgctcaaatgaagcaggatccacagaatgctgacttaaagaaacagcttcatgaactc
caagccaaaatcacagctttgagtgagaaacagaaaagagtagttgaacagctacggaag
aacctgatagtaaagcaagaacaaccggacaagttccaaatacagccattgccacaatct
gaaaacaaactacaaacagcacagcagcaaccactacagcaactacaacaacagcagcag
taccaccaccaccacgcccagcagtcagctgcagcctctcccaacctgactgcttcacag
aagactgtaactacagcttctatgattaccacaaagacactacctctcgtcttgaaagca
gcaactgcgaccatgcctgcctctgtggtgggccagagacctaccattgctatggtgacc
gccatcaacagtcagaaggctgtgctcagcactgatgtgcagaacacaccagtcaacctc
cagacgtctagtaaggtcactgggcctggggcagaggctgtccaaattgtggcaaaaaac
acagtcactctggttcaggcaacacctcctcagcccatcaaagtaccacagtttatcccc
cctcctagactcactccacgtccaaactttcttccacaggttcgacccaagcctgtggcc
cagaataacattcctattgccccagcaccacctcccatgctcgcagctcctcagcttatc
cagaggcccgtcatgctgaccaagttcacccccacaacccttcccacatcccagaattcc
atccaccccgtccgtgtcgtcaatgggcagactgcaaccatagccaaaacgttccccatg
gcccagctcaccagcattgtgatagctactccagggaccagactcgctggacctcaaact
gtacagcttagcaagccaagtcttgaaaaacagacagttaaatctcacacagaaacagat
gagaaacaaacagagagccgcaccatcaccccacctgctgcacccaaaccaaaacgggag
gagaaccctcagaaacttgccttcatggtgtctctagggttggtaacacatgaccatcta
gaagaaatccaaagcaagaggcaagagcgaaaaagaagaacaacagcaaatccggtctac
agtggagcagtctttgagccagagcgtaagaagagtgcagtgacatacctaaacagcaca
atgcaccctgggacccggaagagaggtcgtcctccaaaatacaatgcagtgctggggttt
ggagcccttaccccaacatccccccaatccagtcatcctgactcccctgaaaatgaaaag
acagagaccacattcactttccctgcacctgttcagcctgtgtccctgcccagccccacc
tccacagacggtgatattcatgaggatttttgcagcgtttgcagaaaaagtggccagtta
ctgatgtgcgacacatgttcccgtgtatatcatttggactgcttagacccccctctgaaa
acaattcccaagggcatgtggatctgtcccagatgtcaggaccagatgctgaagaaggaa
gaagcaattccatggcctggaactttagcaattgttcattcctatattgcctacaaagca
gcaaaagaagaagagaaacagaagttacttaaatggagttcagatttaaaacaagaacga
gaacaactagagcaaaaggtgaaacagctcagcaattccataagtaaatgcatggaaatg
aagaacaccatcctggcccggcagaaggagatgcacagctccctggagaaggtaaaacag
ctgattcgcctcatccacggcatcgacctctccaaacctgtagactctgaggccactgtg
ggggccatctccaatggcccggactgcaccccccctgccaatgccgccacctccacgccg
gccccttccccctcctcccagagctgcacagcgaactgtaaccagggggaagagactaaa
taa

DBGET integrated database retrieval system