KEGG   Homo sapiens (human): 51319
Entry
51319             CDS       T01001                                 
Symbol
RSRC1, BM-011, MRT70, SFRS21, SRrp53
Name
(RefSeq) arginine and serine rich coiled-coil 1
  KO
K24594  arginine/serine-rich coiled-coil protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00768  Autosomal recessive intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    51319 (RSRC1)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Step II factors
    51319 (RSRC1)
SSDB
Other DBs
NCBI-GeneID: 51319
NCBI-ProteinID: NP_001258767
OMIM: 613352
HGNC: 24152
Ensembl: ENSG00000174891
Pharos: Q96IZ7(Tdark)
UniProt: Q96IZ7
Position
3:158110089..158545730
AA seq 334 aa
MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRKSRSKSRSWSRDLQPRSH
SYDRRRRHRSSSSSSYGSRRKRSRSRSRGRGKSYRVQRSRSKSRTRRSRSRPRLRSHSRS
SERSSHRRTRSRSRDRERRKGRDKEKREKEKDKGKDKELHNIKRGESGNIKAGLEHLPPA
EQAKARLQLVLEAAAKADEALKAKERNEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSF
VQQTFRSSKEVKKSVEPSEVKQATSTSGPASAVADPPSTEKEIDPTSIPTAIKYQDDNSL
AHPNLFIEKADAEEKWFKRLIALRQERLMGSPVA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgggacgtcggtcatcagatactgaagaagaaagcagaagcaagagaaaaaagaaacac
cgtagacggtcctcctcgagcagttcttcagatagtagaacatacagccgaaagaaagga
ggaaggaaatcaagatcaaagtcaagatcttggtccagagatcttcagcctcgttcacat
tcttatgatagaagacgcaggcatcgatcaagcagtagctcttcttatggctccagaagg
aaacgaagtcgaagtcgttcaaggggtcgagggaaatcctatagagttcagaggtctagg
tcaaaaagcagaacaagaaggtccaggtcaagacctcgtctccgttctcatagtcgtagc
agtgaaaggtccagtcacagaagaacgcgtagtcggtctcgggatagagaacgacgtaag
ggcagagataaagagaaaagagaaaaggagaaggataaagggaaggacaaggaattacat
aacatcaaacgtggggaatctggaaacatcaaagctggattagaacatctgccaccagct
gaacaggccaaagccagactacagctggttcttgaagctgctgcaaaagctgatgaagca
ttgaaagccaaagaaagaaatgaggaagaagcaaagagaagaaaggaggaagaccaagcc
accctggtagaacaagtaaaaagagtaaaagaaattgaagctattgaaagtgattctttt
gttcagcagacattcagatcaagtaaagaagtcaaaaagtcagtggaacctagtgaagtg
aaacaagcaacttcaacatcaggaccagcatcagcagttgctgatccacccagtactgaa
aaagaaatagatcctaccagcatccctactgctatcaagtaccaagatgacaattccctg
gcccatccaaatttatttatcgagaaagctgatgctgaggaaaaatggttcaagagatta
attgctctccgacaagaaagactaatgggcagtcctgtggcctaa

DBGET integrated database retrieval system