KEGG   Homo sapiens (human): 51329
Entry
51329             CDS       T01001                                 
Symbol
ARL6IP4, SFRS20, SR-25, SRp25, SRrp37
Name
(RefSeq) ADP ribosylation factor like GTPase 6 interacting protein 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SR-25 Macoilin
Other DBs
NCBI-GeneID: 51329
NCBI-ProteinID: NP_061164
OMIM: 607668
HGNC: 18076
Ensembl: ENSG00000182196
Vega: OTTHUMG00000168779
Pharos: Q66PJ3(Tdark)
UniProt: Q66PJ3
Position
12:122980233..122982909
AA seq 237 aa
MAHVGSRKRSRSRSRSRGRGSEKRKKKSRKDTSRNCSASTSQGRKASTAPGAEASPSPCI
TERSKQKARRRTRSSSSSSSSSSSSSSSSSSSSSSSSSDGRKKRGKYKDKRRKKKKKRKK
LKKKGKEKAEAQQVEALPGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDAR
QSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
NT seq 714 nt   +upstreamnt  +downstreamnt
atggctcacgtcggctcccgcaagcgctcgaggagtcgcagccggtcccggggacggggg
tcggaaaagagaaagaagaagagcaggaaagacacctcgaggaactgctcggcctccaca
tcccaaggtcgcaaggccagcacggcccctggggcggaggcctcaccttctccctgcatc
acagagagaagcaagcagaaggcccggaggagaacaagatccagctcctcctcctcttct
tccagttcttctagctcctcttcttcctcctcgtcctcctcctcttcctccagtgatggc
cggaagaagcgggggaagtacaaggacaagaggaggaagaagaagaagaagaggaagaag
ctgaagaagaagggcaaggagaaggcggaagcacagcaggtggaggctctgccgggcccc
tcgctggaccagtggcaccgatcagctggggaggaagaggatggcccagtcctgacggat
gagcagaagtcccgaatccaggccatgaagcccatgaccaaggaggagtgggatgcccgg
cagagcatcatccgcaaggtggtggaccctgagacggggcgcaccaggcttattaaggga
gatggcgaggtcctagaggaaatcgtaaccaaagaacgacacagagagatcaacaagcaa
gccacccgaggggactgcctggccttccagatgcgagctgggttgcttccctga

DBGET integrated database retrieval system