KEGG   Homo sapiens (human): 5133Help
Entry
5133              CDS       T01001                                 

Gene name
PDCD1, CD279, PD-1, PD1, SLEB2, hPD-1, hPD-l, hSLE1
Definition
(RefSeq) programmed cell death 1
  KO
K06744  programmed cell death protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04660  T cell receptor signaling pathway
Disease
H00080  Systemic lupus erythematosus
H01490  Multiple sclerosis
H01812  Rasmussen encephalitis
Drug target
Nivolumab: D10316
Pembrolizumab: D10574
Pidilizumab: D10390
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5133 (PDCD1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5133 (PDCD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    5133 (PDCD1)
CD molecules [BR:hsa04090]
 Proteins
  5133 (PDCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 ig I-set Ig_2 RskA
Motif
Other DBs
NCBI-GeneID: 5133
NCBI-ProteinID: NP_005009
OMIM: 600244
HGNC: 8760
Ensembl: ENSG00000188389
Vega: OTTHUMG00000151342
Pharos: Q15116(Tclin)
UniProt: Q15116 A0A0M3M0G7
Structure
PDB: 

Position
2q37.3
AA seq 288 aa AA seqDB search
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcccacaggcgccctggccagtcgtctgggcggtgctacaactgggctggcgg
ccaggatggttcttagactccccagacaggccctggaacccccccaccttctccccagcc
ctgctcgtggtgaccgaaggggacaacgccaccttcacctgcagcttctccaacacatcg
gagagcttcgtgctaaactggtaccgcatgagccccagcaaccagacggacaagctggcc
gccttccccgaggaccgcagccagcccggccaggactgccgcttccgtgtcacacaactg
cccaacgggcgtgacttccacatgagcgtggtcagggcccggcgcaatgacagcggcacc
tacctctgtggggccatctccctggcccccaaggcgcagatcaaagagagcctgcgggca
gagctcagggtgacagagagaagggcagaagtgcccacagcccaccccagcccctcaccc
aggccagccggccagttccaaaccctggtggttggtgtcgtgggcggcctgctgggcagc
ctggtgctgctagtctgggtcctggccgtcatctgctcccgggccgcacgagggacaata
ggagccaggcgcaccggccagcccctgaaggaggacccctcagccgtgcctgtgttctct
gtggactatggggagctggatttccagtggcgagagaagaccccggagccccccgtgccc
tgtgtccctgagcagacggagtatgccaccattgtctttcctagcggaatgggcacctca
tcccccgcccgcaggggctcagctgacggccctcggagtgcccagccactgaggcctgag
gatggacactgctcttggcccctctga

DBGET integrated database retrieval system