KEGG   Homo sapiens (human): 51330Help
Entry
51330             CDS       T01001                                 

Gene name
TNFRSF12A, CD266, FN14, TWEAKR
Definition
(RefSeq) TNF receptor superfamily member 12A
  KO
K05149  tumor necrosis factor receptor superfamily member 12A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Drug target
Enavatuzumab: D09896
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    51330 (TNFRSF12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    51330 (TNFRSF12A)
   04090 CD molecules [BR:hsa04090]
    51330 (TNFRSF12A)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   51330 (TNFRSF12A)
CD molecules [BR:hsa04090]
 Proteins
  51330 (TNFRSF12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: stn_TNFRSF12A
Motif
Other DBs
NCBI-GeneID: 51330
NCBI-ProteinID: NP_057723
OMIM: 605914
HGNC: 18152
Ensembl: ENSG00000006327
Vega: OTTHUMG00000129001
Pharos: Q9NP84(Tbio)
UniProt: Q9NP84
Structure
PDB: 

Position
16p13.3
AA seq 129 aa AA seqDB search
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH
SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE
GCPAVALIQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggctcggggctcgctgcgccggttgctgcggctcctcgtgctggggctctggctggcg
ttgctgcgctccgtggccggggagcaagcgccaggcaccgccccctgctcccgcggcagc
tcctggagcgcggacctggacaagtgcatggactgcgcgtcttgcagggcgcgaccgcac
agcgacttctgcctgggctgcgctgcagcacctcctgcccccttccggctgctttggccc
atccttgggggcgctctgagcctgaccttcgtgctggggctgctttctggctttttggtc
tggagacgatgccgcaggagagagaagttcaccacccccatagaggagaccggcggagag
ggctgcccagctgtggcgctgatccagtga

DBGET integrated database retrieval system