KEGG   Homo sapiens (human): 51332Help
Entry
51332             CDS       T01001                                 

Gene name
SPTBN5, BSPECV, HUBSPECV, HUSPECV
Definition
(RefSeq) spectrin beta, non-erythrocytic 5
  KO
K06115  spectrin beta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    51332 (SPTBN5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     51332 (SPTBN5)
  Intermediate filaments
   Intermediate filament-binding proteins
    51332 (SPTBN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin CH PH PH_9 CAMSAP_CH
Motif
Other DBs
NCBI-GeneID: 51332
NCBI-ProteinID: NP_057726
OMIM: 605916
HGNC: 15680
Ensembl: ENSG00000137877
Vega: OTTHUMG00000172720
Pharos: Q9NRC6(Tbio)
UniProt: Q9NRC6
Position
15q15.1
AA seq 3674 aa AA seqDB search
MAGQPHSPRELLGAAGHRSRRPSTELRVPPSPSLTMDSQYETGHIRKLQARHMQMQEKTF
TKWINNVFQCGQAGIKIRNLYTELADGIHLLRLLELISGEALPPPSRGRLRVHFLENSSR
ALAFLRAKVPVPLIGPENIVDGDQTLILGLIWVIILRFQISHISLDKEEFGASAALLSTK
EALLVWCQRKTASYTNVNITDFSRSWSDGLGFNALIHAHRPDLLDYGSLRPDRPLHNLAF
AFLVAEQELGIAQLLDPEDVAAAQPDERSIMTYVSLYYHYCSRLHQGQTVQRRLTKILLQ
LQETELLQTQYEQLVADLLRWIAEKQMQLEARDFPDSLPAMRQLLAAFTIFRTQEKPPRL
QQRGAAEALLFRLQTALQAQNRRPFLPHEGLGLAELSQCWAGLEWAEAARSQALQQRLLQ
LQRLETLARRFQHKAALRESFLKDAEQVLDQARAPPASLATVEAAVQRLGMLEAGILPQE
GRFQALAEIADILRQEQYHSWADVARRQEEVTVRWQRLLQHLQGQRKQVADMQAVLSLLQ
EVEAASHQLEELQEPARSTACGQQLAEVVELLQRHDLLEAQVSAHGAHVSHLAQQTAELD
SSLGTSVEVLQAKARTLAQLQQSLVALVRARRALLEQTLQRAEFLRNCEEEEAWLKECGQ
RVGNAALGRDLSQIAGALQKHKALEAEVHRHQAVCVDLVRRGRDLSARRPPTQPDPGERA
EAVQGGWQLLQTRVVGRGARLQTALLVLQYFADAAEAASWLRERRSSLERASCGQDQAAA
ETLLRRHVRLERVLRAFAAELRRLEEQGRAASARASLFTVNSALSPPGESLRNPGPWSEA
SCHPGPGDAWKMALPAEPDPDFDPNTILQTQDHLSQDYESLRALAQLRRARLEEAMALFG
FCSSCGELQLWLEKQTVLLQRVQPQADTLEVMQLKYENFLTALAVGKGLWAEVSSSAEQL
RQRYPGNSTQIQRQQEELSQRWGQLEALKREKAVQLAHSVEVCSFLQECGPTQVQLRDVL
LQLEALQPGSSEDTCHALQLAQKKTLVLERRVHFLQSVVVKVEEPGYAESQPLQGQVETL
QGLLKQVQEQVAQRARRQAETQARQSFLQESQQLLLWAESVQAQLRSKEVSVDVASAQRL
LREHQDLLEEIHLWQERLQQLDAQSQPMAALDCPDSQEVPNTLRVLGQQGQELKVLWEQR
QQWLQEGLELQKFGREVDGFTATCANHQAWLHLDNLGEDVREALSLLQQHREFGRLLSTL
GPRAEALRAHGEKLVQSQHPAAHTVREQLQSIQAQWTRLQGRSEQRRRQLLASLQLQEWK
QDVAELMQWMEEKGLMAAHEPSGARRNILQTLKRHEAAESELLATRRHVEALQQVGRELL
SRRPCGQEDIQTRLQGLRSKWEALNRKMTERGDELQQAGQQEQLLRQLQDAKEQLEQLEG
ALQSSETGQDLRSSQRLQKRHQQLESESRTLAAKMAALASMAHGMAASPAILEETQKHLR
RLELLQGHLAIRGLQLQASVELHQFCHLSNMELSWVAEHMPHGSPTSYTECLNGAQSLHR
KHKELQVEVKAHQGQVQRVLSSGRSLAASGHPQAQHIVEQCQELEGHWAELERACEARAQ
CLQQAVTFQQYFLDVSELEGWVEEKRPLVSSRDYGRDEAATLRLINKHQALQEELAIYWS
SMEELDQTAQTLTGPEVPEQQRVVQERLREQLRALQELAATRDRELEGTLRLHEFLREAE
DLQGWLASQKQAAKGGESLGEDPEHALHLCTKFAKFQHQVEMGSQRVAACRLLAESLLER
GHSAGPMVRQRQQDLQTAWSELWELTQARGHALRDTETTLRVHRDLLEVLTQVQEKATSL
PNNVARDLCGLEAQLRSHQGLERELVGTERQLQELLETAGRVQKLCPGPQAHAVQQRQQA
VTQAWAVLQRRMEQRRAQLERARLLARFRTAVRDYASWAARVRQDLQVEESSQEPSSGPL
KLSAHQWLRAELEAREKLWQQATQLGQQALLAAGTPTKEVQEELRALQDQRDQVYQTWAR
KQERLQAEQQEQLFLRECGRLEEILAAQEVSLKTSALGSSVEEVEQLIRKHEVFLKVLTA
QDKKEAALRERLKTLRRPRVRDRLPILLQRRMRVKELAESRGHALHASLLMASFTQAATQ
AEDWIQAWAQQLKEPVPPGDLRDKLKPLLKHQAFEAEVQAHEEVMTSVAKKGEALLAQSH
PRAGEVSQRLQGLRKHWEDLRQAMALRGQELEDRRNFLEFLQRVDLAEAWIQEKEVKMNV
GDLGQDLEHCLQLRRRLREFRGNSAGDTVGDACIRSISDLSLQLKNRDPEEVKIICQRRS
QLNNRWASFHGNLLRYQQQLEGALEIHVLSRELDNVTKRIQEKEALIQALDCGKDLESVQ
RLLRKHEELEREVHPIQAQVESLEREVGRLCQRSPEAAHGLRHRQQEVAESWWQLRSRAQ
KRREALDALHQAQKLQAMLQELLVSAQRLRAQMDTSPAPRSPVEARRMLEEHQECKAELD
SWTDSISLARSTGQQLLTAGHPFSSDIRQVLAGLEQELSSLEGAWQEHQLQLQQALELQL
FLSSVEKMERWLCSKEDSLASEGLWDPLAPMEPLLWKHKMLEWDLEVQAGKISALEATAR
GLHQGGHPEAQSALGRCQAMLLRKEALFRQAGTRRHRLEELRQLQAFLQDSQEVAAWLRE
KNLVALEEGLLDTAMLPAQLQKQQNFQAELDASMHQQQELQREGQRLLQGGHPASEAIQE
RLEELGALWGELQDNSQKKVAKLQKACEALRLRRSMEELENWLEPIEVELRAPTVGQALP
GVGELLGTQRELEAAVDKKARQAEALLGQAQAFVREGHCLAQDVEEQARRLLQRFKSLRE
PLQERRTALEARSLLLKFFRDADEEMAWVQEKLPLAAAQDYGQSLSAVRHLQEQHQNLES
EMSSHEALTRVVLGTGYKLVQAGHFAAHEVAARVQQLEKAMAHLRAEAARRRLLLQQAQE
AQQFLTELLEAGSWLAERGHVLDSEDMGHSAEATQALLRRLEATKRDLEAFSPRIERLQQ
TAALLESRKNPESPKVLAQLQAVREAHAELLRRAEARGHGLQEQLQLHQLERETLLLDAW
LTTKAATAESQDYGQDLEGVKVLEEKFDAFRKEVQSLGQAKVYALRKLAGTLERGAPRRY
PHIQAQRSRIEAAWERLDQAIKARTENLAAAHEVHSFQQAAAELQGRMQEKTALMKGEDG
GHSLSSVRTLQQQHRRLERELEAMEKEVARLQTEACRLGQLHPAAPGGLAKVQEAWATLQ
AKAQERGQWLAQAAQGHAFLGRCQELLAWAQERQELASSEELAEDVAGAEQLLGQHEELG
QEIRECRLQAQDLRQEGQQLVDNSHFMSAEVTECLQELEGRLQELEEAWALRWQRCAESW
GLQKLRQRLEQAEAWLACWEGLLLKPDYGHSVSDVELLLHRHQDLEKLLAAQEEKFAQMQ
KTEMEQELLLQPQELKPGRAGSSLTSFQWRPSGHQGLGAQLAETRDPQDAKGTPTMEGSL
EFKQHLLPGGRQPSSSSWDSCRGNLQGSSLSLFLDERMAAEKVASIALLDLTGARCERLR
GRHGRKHTFSLRLTSGAEILFAAPSEEQAESWWRALGSTAAQSLSPKLKAKPVSSLNECT
TKDARPGCLLRSDP
NT seq 11025 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcagccccacagtccccgggagctcctcggggctgcagggcaccgcagcagg
aggcccagcacagaactccgggtcccgcccagtccaagtctcaccatggactctcagtac
gagacgggccacattcgcaagctacaggcccggcacatgcagatgcaggagaagactttc
accaagtggatcaataacgtcttccagtgcggccaggcgggcatcaagatccggaacctg
tacacagagctggctgacggcatccacctcctgcggctgctggagctcatctcaggggag
gccctgccacccccgagccggggccgcctgcgtgtgcacttcctggagaacagcagccga
gctctggccttcctcagggccaaggtgccagtaccactcatcgggccagagaacatcgtg
gacggagaccagacactcatcctgggactcatctgggtcatcattctgcgtttccagatc
tcccacatctccttggacaaggaggagtttggggccagcgcagccctgctgtccaccaag
gaagccctgctggtctggtgccagcggaagacagccagctacaccaacgtgaacattaca
gatttctcccgaagctggagcgatgggctgggcttcaatgccctcatccatgcccacagg
ccagacctgttggactacggctccctgcgtccagaccgcccactgcacaaccttgctttt
gctttcctggtggctgagcaggagctgggcattgctcagctgctggaccccgaggacgtg
gcagccgcacagccagatgagcgctctatcatgacctacgtctccctctactaccactac
tgctcccgcctgcatcaggggcagactgtccagaggagactcactaagatcctgcttcag
ctccaggagacagagctgctgcagacccagtacgagcagctggtggctgaccttctacgc
tggattgcagagaagcagatgcagctggaggcgcgggattttccagactcgctgcccgcc
atgcggcagctactggcagcattcaccatcttccgcacccaggagaagccaccccggcta
cagcagcgaggggccgcagaggccctgctcttccggctacagacagcactccaagcccag
aaccgcaggcccttcctgcctcatgagggcctgggccttgcagagctgtcccagtgctgg
gcagggctggagtgggcagaggctgcaaggagccaggccctgcagcagaggctactgcag
ctgcagcggctagaaaccctggcccggcgcttccagcacaaggcagccctccgggagagt
ttccttaaggatgcagagcaggtgctagaccaggccagagccccgccagccagcctggcc
acagtggaggcagccgtccagaggctgggcatgctggaggctggcatcctgccccaggag
gggcgcttccaggccctggctgagatcgcagacatcctccggcaggagcagtaccacagc
tgggcagatgtggcccgcaggcaggaggaagttaccgtgcgctggcagaggctccttcag
catctacagggacagaggaagcaggtggcagacatgcaggctgtgctgagcctgctgcag
gaggtggaggctgcctcccaccagctggaggagctgcaggagccggccaggtccaccgcc
tgtgggcagcagctggcagaagtggtggagctgctgcagaggcatgacctgctggaggct
caagtctcggcccacggagcccatgtgagccatcttgctcagcagacagcagagctggac
tcctccctgggcaccagtgtggaggtgctgcaggccaaggccaggacactggcccagctc
caacagagcctggtggctcttgtcagggcccggcgggccctgctggagcagaccctgcag
cgggcagagttcctgcgcaactgtgaggaggaggaagcctggctgaaggagtgcggacag
cgggtggggaatgcggccctgggccgggatctcagccagatcgcaggcgccctgcagaaa
cacaaggccctggaagctgaggtccaccgccaccaggccgtgtgcgtagatctcgtgcgg
aggggacgcgacctcagcgcccgcaggcccccaacgcagccggatcccggggaacgggca
gaggccgttcagggagggtggcagctgctccagacccgggtggtggggcggggcgcacgg
ctgcagacagccctgctggtcctgcagtacttcgcggacgcggcggaggcggcttcgtgg
ctgcgcgagcggcgatcctcgctggagagagcgtcctgcggtcaggaccaggcggccgcc
gagaccctgctgaggcgccacgtgcggctggagcgcgtcctgcgcgccttcgcggccgag
ctgcggcggctggaggagcaggggcgggcggcctcggcccgggcgtcgttattcacggtg
aactctgccctgagccctccaggagaaagcctgaggaacccagggccctggagtgaggct
tcctgccaccctggccctggggatgcctggaagatggccctcccagctgagcctgaccct
gactttgatcccaacactatactccagacacaggaccacttgagtcaggactatgagagt
ctgcgggccctggcacagctccgcagggcccggttggaggaggccatggccctgttcggt
ttctgcagttcctgtggggagctccagttgtggctggagaagcagacagtgctgctccaa
agggtgcagccccaggctgacaccctggaggtcatgcagctcaaatatgagaacttcctc
actgccctggctgtgggaaagggcctctgggctgaggtcagcagctctgctgagcaactg
aggcagagatatcctgggaactccacacaaatccaacgacagcaggaggaactgagccag
aggtgggggcagctggaggccctgaagagggagaaggccgtgcagctggcacacagtgtg
gaagtgtgcagttttctgcaggagtgtggacccacacaggtccagctgcgagacgtgctc
ctccagctggaggccctgcagccagggagctcagaggacacctgccacgccctgcagctg
gcccagaagaagaccctggtgctggagaggagggtccacttcctccaaagtgtggtcgta
aaggtcgaggagccaggctacgcagagagccagcctctgcaaggacaggtggagacactg
caggggctgctgaagcaagtacaggaacaagtggcccaacgggcccggcgccaggctgag
actcaggcccggcagagcttcctgcaagagagccagcaactgctactgtgggcagagagt
gtccaggctcagctgcgcagcaaggaggtgtcagtggatgtggcctcggctcagcggctg
ctgagggagcaccaagacctgctggaggagatccacctgtggcaggagaggctgcagcag
ctggacgctcagagccagcccatggcagccttggactgcccagactcccaagaggtgccc
aacactctgagggtcctggggcagcagggccaggagctgaaggttttgtgggagcagagg
cagcagtggctgcaagaggggctggagctgcagaagtttggccgagaagtggatggtttc
actgccacctgtgccaaccaccaggcctggctgcacctggacaaccttggggaggacgtg
agggaggccctgagcctgctgcagcagcaccgggagtttgggcggctcctgagcaccctg
gggcctcgggcagaggctctgcgggcacacggcgagaagctggttcagagccagcaccca
gctgcacacacggtcagagagcagctgcagagtatccaggcacagtggaccaggctccag
gggaggagtgagcagaggaggaggcagttgctggcttccctccagctccaggagtggaag
caggatgtggcagagctgatgcagtggatggaagagaaggggctgatggctgcgcatgag
ccctccggagcgcgcagaaacatcctgcagacactcaagcggcacgaagcagctgagagc
gagctactcgccacccgcagacacgtggaggccctgcagcaggttgggagagagctgttg
agtaggaggccctgtggccaggaggacatacagaccaggcttcaaggcctgagaagcaag
tgggaagctttgaaccgcaagatgactgagcgtggggacgagctccagcaggctggacag
caggagcaactcctgaggcagctgcaggatgcaaaggagcagctggagcagctcgaaggg
gccctacagagctcggaaacagggcaggacctgcgctccagccagaggctgcagaaacgg
caccaacagctggagagtgagagccggaccctggctgccaagatggctgccctcgcctcc
atggcccatggcatggccgcctccccggccatcctggaagagacccagaagcacctccgg
aggctggagcttctgcaggggcatctggccatccggggcctgcagctgcaggcctcagtg
gagctgcaccagttctgccacctgagcaacatggagctctcttgggtagccgagcacatg
ccccatggcagccccaccagctataccgagtgcttgaatggtgcccagagccttcaccgc
aagcacaaggagctccaggtggaggtaaaagctcaccaggggcaggtgcaacgggtgctg
agttctgggcggagcctggcagcctcagggcacccccaagcccaacacatcgtggagcag
tgccaggagctggaaggccactgggcagagctggagagggcatgtgaagcgcgggcccag
tgtctgcagcaggctgtcactttccagcagtactttctggatgtgtcagagctggagggc
tgggtggaggagaagcggccgctggtgagcagtcgggactatggcagagacgaggcagcc
accctcaggctcattaacaagcaccaggctctacaggaggaactagccatttactggagc
tccatggaggagcttgaccagacggcccaaaccctcactggccccgaagtccctgagcag
cagcgtgtggtgcaggagaggctccgggagcagctgcgggcactgcaggagttggcggcc
acacgggaccgggaactggaggggaccctgaggctgcatgagttcctgagggaggctgag
gacctgcagggctggctggcaagccagaagcaggcagccaaaggaggggagagcctggga
gaggaccccgagcacgccctgcacctctgcaccaagtttgcaaagtttcagcaccaagtg
gagatgggcagccagcgggtggccgcctgccggctgctggcggagagcctgctagagcgt
gggcacagtgctggccccatggtccgtcagaggcagcaggatctgcagaccgcctggtcg
gagctgtgggagctgacccaggcccgaggccacgcgctccgagacaccgagaccaccctc
agagttcacagagatctcttggaagtcctcacccaggtccaggagaaagccacgagcctc
cccaacaatgtggcacgggacctgtgtgggctggaggcgcagctgagaagccaccagggg
ctggagcgagaactcgtgggcaccgagcggcagctgcaggaactgctggagactgcaggc
agggtgcagaagctgtgtccggggcctcaggcccatgcggtgcagcagaggcagcaagct
gtgacgcaggcgtgggcagtgctgcagcgacgcatggagcagcgcagggcccagctggag
cgggcacgcctcctggcccgcttccgcacggcggtgcgtgactatgcctcctgggcagcc
cgcgtgcgccaggacctgcaggtggaggagagttcgcaagagcctagcagtggcccgctg
aagctcagtgcccaccagtggctccgggcggagctggaggcccgggagaagctgtggcag
caggccacccagctggggcagcaggcacttcttgctgcagggacacccaccaaggaggtc
caggaagagcttcgagccctgcaggaccagcgggaccaggtgtatcagacctgggcacgg
aagcaagagaggctgcaggccgagcagcaggagcagctcttcctcagagagtgcggccgc
ctggaggagatcctcgcggcccaggaggtctccctgaaaaccagtgccttggggagctcg
gtggaagaggtagagcagttgattcgcaagcacgaggtcttcctgaaggttctgactgcc
caggacaagaaggaggcagccctgcgtgagcggctgaagacgctccggcgcccccgggtg
cgggaccggcttcccatcctgctgcagcgccggatgagagtgaaggagctggcggagagc
cggggacacgccctgcatgcctccctgctgatggccagcttcacccaggccgcaacccag
gctgaggactggatccaggcgtgggcccagcagctgaaggagccggtccctcctggggac
ctgagagataagctgaagcccctgctgaaacaccaggcctttgaggctgaagtccaggcc
catgaggaggtcatgacctctgttgccaagaagggagaggctctcctggcacagagtcac
cctcgagccggagaggtctcccagcggctgcagggcctgcggaagcactgggaggacctg
aggcaggcaatggccctcaggggccaggagctggaggacaggcggaacttcctggagttc
ctgcagagagtggaccttgcagaggcctggatccaggagaaggaggtgaagatgaatgtt
ggtgacctgggccaggacctggagcactgcctgcagctccgacggcggctccgcgagttc
cgaggaaactcggccggggacacagtgggtgatgcctgcatcaggagcatcagtgacttg
tcactgcagctcaagaaccgggaccctgaggaagtcaagatcatctgccagcggcgaagc
cagctcaacaacaggtgggcgagtttccatggcaacttgctccggtaccagcagcagctc
gaaggggccttggagatacacgtgttgtcccgagagctggacaatgtcaccaagaggatt
caggagaaggaagccctgatccaggccctggactgtgggaaagatctggagagcgtgcag
aggctgctgcggaaacacgaggagctggagcgggaagtgcaccccatccaggcccaggtg
gagtccctagagcgtgaagtgggccgcctctgccaaagaagccccgaggcagcccacggc
ctcaggcacaggcagcaggaggtggctgagagctggtggcagctccggagcagggcccag
aagcggagggaggcgctggatgccttgcaccaagctcagaaactccaggcaatgctgcag
gaattgctggtcagcgcccagaggctgcgggctcagatggacacgagccccgctcctcgc
agccctgtggaagcccggcgtatgttagaagagcatcaggagtgcaaggccgagctggac
tcctggacagacagcatcagcctggcccgaagcactgggcagcaactgctcacagcgggg
caccccttcagctccgacattcgccaggtgctggctggcttagaacaggagctgagcagc
ctggaaggggcctggcaggagcatcagctacagctgcagcaggccctggagctacagctg
tttctgagctcagtggagaagatggaacgttggctttgcagcaaggaagactccctagcc
agtgagggtctatgggaccccttggcccccatggagccccttctgtggaagcacaagatg
ctggagtgggacctggaggtgcaggcgggaaagatcagtgctctggaggccacggcccgc
ggcctgcaccagggtgggcaccccgaggcccagagtgccctgggcaggtgccaggccatg
cttctgaggaaggaggcgctcttcaggcaagccgggacccgccgccatcgcctggaggag
ctccggcagctgcaggccttcctgcaggactcccaggaggtggctgcgtggctgagggag
aagaacctggtggccttggaggagggtttgctggacacagccatgctgccagcacagtta
cagaagcagcagaatttccaggcggagctggacgcgagcatgcaccaacagcaggagctg
cagcgggagggacagaggctgctgcaggggggccacccagcctcggaggccatccaggag
cgactggaggagctgggagcactctggggtgagctgcaagacaactcccagaagaaggtg
gccaagctccagaaggcctgtgaggccctgcgtctgcggcggagcatggaggaactggag
aactggctggagcccatcgaggttgagctgagagcccccactgtgggccaggccctgcct
ggggtgggcgagctcctgggcacacagagggagctggaggcagcagtggacaagaaggcc
aggcaggctgaggcactgctgggccaggcccaggcctttgtgagggaaggccactgcctt
gcccaagatgtggaagagcaggcccggcggctgcttcagaggttcaagagcctgagggag
cccctgcaggagcgcaggacggccctggaggcccggagcctcctcttgaagttcttcagg
gacgccgacgaggaaatggcctgggtgcaggagaagctgcctctggccgctgcccaggac
tatggccagagcctgagtgcggtgcggcacctgcaggagcagcaccagaacctggagagt
gagatgagcagccacgaggctctgacccgggtggtgctgggcactgggtacaagctggtg
caggctgggcactttgccgcccacgaggtggccgcccgggtgcagcagctggagaaggcc
atggcccacctgcgggcagaggcggcgcggaggcggcttctgctgcagcaggctcaggag
gcccagcagtttctgactgagctcctggaggcgggatcctggctggctgagcggggccat
gtcctggacagcgaggacatgggccacagtgctgaagccacacaggcccttctgcggcgg
ctggaggccaccaagagagacctggaagcgttcagcccacgcatcgagcggctgcagcag
acagcagcactcctggagagcaggaagaacccagaaagccccaaggtgctagcccagctg
caggcagttcgggaggcccacgcagagctgctgcggagggcggaggccagggggcacggc
ctgcaggagcagctgcagctacaccagctggagcgagagaccctgctcctcgacgcctgg
ctgaccaccaaggcggccaccgccgagtcccaggactacgggcaggacctggagggtgtc
aaggtgctggaagagaagtttgatgctttcagaaaggaagtgcagagcctgggccaggcc
aaggtgtatgccctgaggaagttggcaggcaccctggagcggggtgcacccaggcgctat
ccccacatccaagcccagaggagccgcattgaggctgcttgggagaggttggaccaagca
ataaaagcccgcacagagaacttggctgcagcccatgaggtccacagctttcagcaggca
gcagctgagctccagggaaggatgcaggagaagacggccctgatgaagggggaggacgga
ggccacagcctgtcatctgtgcggaccctgcagcaacagcacaggcgcctggagagagag
ctggaagctatggagaaggaggtggcacggctacagacggaggcctgccgactgggccag
ctacatcctgcagctccggggggcctggccaaggtgcaggaggcctgggccaccctgcag
gcgaaggcccaggagcgaggccagtggctggcgcaggctgcacagggccatgccttcctc
gggcgctgccaggaactgctagcatgggcacaggagaggcaggagctggcgtcctccgag
gagctggctgaggacgtggcgggggctgagcagctccttgggcagcatgaagagctgggg
caagaaatcagggagtgccgccttcaagcccaggacctgcggcaggaaggacagcagctg
gtggacaacagccacttcatgtctgcggaggtgacagagtgcctgcaggagctggaaggg
cggctgcaggagctggaggaggcttgggccctgcgctggcaacgctgtgccgagagctgg
ggcctgcagaagcttcggcagaggctggagcaggctgaggcctggctggcctgctgggag
ggactcctgctgaagcccgactatgggcactcagtgtcagatgtggagttgctgctgcac
agacaccaggacttagaaaagctgctggcagcccaggaagagaagtttgcccaaatgcaa
aagacagagatggaacaggagctcctgctgcagccacaggagctgaagcccgggagagct
ggcagctcgctgacatcctttcagtggaggccctctggacaccaggggctaggagcacag
ctggctgagacgagggacccccaggatgcaaagggtacccccaccatggaggggtctttg
gagttcaagcagcacctgctgcctggcgggaggcagcctagctcgagctcctgggacagc
tgccgcgggaacttgcagggcagctctctgagcctgttcctggatgagaggatggcagcg
gagaaagtagcttccatagccctccttgacctcacgggagcccggtgtgagaggctgcgg
ggccgccacggcaggaaacacacattctccttaaggctgaccagtggggcagagatcctg
tttgcagcaccgtccgaagagcaggctgagagctggtggcgagccctgggcagcactgca
gcccagagtctgagcccaaaactcaaagccaaacctgtcagctctctgaatgagtgcacg
accaaggatgcccggcctggatgtctactcaggtctgatccctga

DBGET integrated database retrieval system