KEGG   Homo sapiens (human): 51335
Entry
51335             CDS       T01001                                 
Symbol
NGRN, DSC92
Name
(RefSeq) neugrin, neurite outgrowth associated
  KO
K23496  neugrin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51335 (NGRN)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    51335 (NGRN)
SSDB
Motif
Pfam: Neugrin MRP-L20 UPF0122
Other DBs
NCBI-GeneID: 51335
NCBI-ProteinID: NP_001028260
OMIM: 616718
HGNC: 18077
Ensembl: ENSG00000182768
UniProt: Q9NPE2
Position
15:90265663..90272211
AA seq 291 aa
MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEERELQEVESTLKRQ
KQAIRFQKIRRQMEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRR
VLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEA
SSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSD
SESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggcggttaccctgagtctcttgctgggcgggcgcgtttgcgccgccgtcactcgctgt
gggttcgcgacccggggggtggcgggcccaggccctattggccgggagccggaccccgat
tccgactgggagccggaggaacgggagctgcaggaggtggagagcaccctgaaacgacag
aaacaagcaatccgattccagaaaattcggaggcaaatggaggcgcctggtgccccgccc
aggaccctgacgtgggaagccatggagcagatacggtatttacatgaggaatttccagag
tcctggtcagttcccaggttggctgaaggctttgatgtcagcactgatgtgatccgaaga
gttttaaaaagcaagtttttacccacattggagcagaagctgaagcaggatcaaaaagtc
cttaagaaagctgggcttgcccactcgctgcagcacctccggggctctggaaatacctca
aagctgctccctgcaggccactctgtatcaggctctttgcttatgccagggcatgaagcc
tcatctaaagacccaaatcacagcacagctttgaaagtgatagagtcagacactcacagg
acaaatacaccaaggagaaggaagggaagaaataaagaaatccaggacctggaggagagc
tttgtgcctgttgctgcacccctaggtcatccaagagagctgcagaagtactccagtgat
tctgagagccccagaggaactggcagtggtgcgttgccaagtggtcagaagctggaggag
ttgaaggcagaggagccagataacttcagcagcaaagtagtgcagaggggccgagagttc
tttgacagcaacgggaacttcctgtacagaatttga

DBGET integrated database retrieval system