KEGG   Homo sapiens (human): 51337
Entry
51337             CDS       T01001                                 
Symbol
THEM6, C8orf55, DSCD75
Name
(RefSeq) thioesterase superfamily member 6
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: 4HBT_2 4HBT Acyl-ACP_TE
Other DBs
NCBI-GeneID: 51337
NCBI-ProteinID: NP_057731
HGNC: 29656
Ensembl: ENSG00000130193
Pharos: Q8WUY1(Tbio)
UniProt: Q8WUY1
Position
8:142727223..142736927
AA seq 208 aa
MLGLLVALLALGLAVFALLDVWYLVRLPCAVLRARLLQPRVRDLLAEQRFPGRVLPSDLD
LLLHMNNARYLREADFARVAHLTRCGVLGALRELRAHTVLAASCARHRRSLRLLEPFEVR
TRLLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVEPPELPAD
LQHWISYNEASSQLLRMESGLSDVTKDQ
NT seq 627 nt   +upstreamnt  +downstreamnt
atgctggggctgctggtggcgttgctggccctggggctcgctgtctttgcgctgctggac
gtctggtacctggtgcgccttccgtgcgccgtgctgcgcgcgcgcctgctgcagccgcgc
gtccgtgacctgctagctgagcagcgcttcccgggccgcgtgctgccctcggacttggac
ctgctgctgcacatgaacaacgcgcgctacctgcgcgaggccgactttgcgcgcgtcgcg
cacctgacccgctgcggggtgctcggggcgctgagggagttgcgggcgcacacggtgctg
gcggcctcgtgcgcgcgccaccgccgctcgctgcgcctgctggagcccttcgaggtgcgc
acccgcctgctgggctgggacgaccgcgcgttctacctggaggcgcgctttgtcagcctg
cgggacggcttcgtgtgcgcgctgctgcgcttccggcagcacctgctgggcacctcaccc
gagcgcgtcgtgcagcacctgtgccagcgcagggtggagccccctgagctgcccgctgat
ctgcagcactggatctcctacaacgaggccagcagccagctgctccgcatggagagtggg
ctcagtgatgtcaccaaggaccagtga

DBGET integrated database retrieval system