KEGG   Homo sapiens (human): 51339
Entry
51339             CDS       T01001                                 

Gene name
DACT1, DAPPER, DAPPER1, DPR1, FRODO, HDPR1, TBS2, THYEX3
Definition
(RefSeq) dishevelled binding antagonist of beta catenin 1
  KO
K22154  dapper
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    51339 (DACT1)
SSDB
Motif
Pfam: Dapper LURAP DUF4530
Other DBs
NCBI-GeneID: 51339
NCBI-ProteinID: NP_057735
OMIM: 607861
HGNC: 17748
Ensembl: ENSG00000165617
Vega: OTTHUMG00000140324
Pharos: Q9NYF0(Tbio)
UniProt: Q9NYF0
Position
14q23.1
AA seq 836 aa
MKPSPAGTAKELEPPAPARGEQRTAEPEGRWREKGEADTERQRTRERQEATLAGLAELEY
LRQRQELLVRGALRGAGGAGAAAPRAGELLGEAAQRSRLEEKFLEENILLLRKQLNCLRR
RDAGLLNQLQELDKQISDLRLDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVF
SECLSSCHSSTCFCSPLEATLSLSDGCPKSADLIGLLEYKEGHCEDQASGAVCRSLSTPQ
FNSLDVIADVNPKYQCDLVSKNGNDVYRYPSPLHAVAVQSPMFLLCLTGNPLREEDRLGN
HASDICGGSELDAVKTDSSLPSPSSLWSASHPSSSKKMDGYILSLVQKKTHPVRTNKPRT
SVNADPTKGLLRNGSVCVRAPGGVSQGNSVNLKNSKQACLPSGGIPSLNNGTFSPPKQWS
KESKAEQAESKRVPLPEGCPSGAASDLQSKHLPKTAKPASQEHARCSAIGTGESPKESAQ
LSGASPKESPSRGPAPPQENKVVQPLKKMSQKNSLQGVPPATPPLLSTAFPVEERPALDF
KSEGSSQSLEEAHLVKAQFIPGQQPSVRLHRGHRNMGVVKNSSLKHRGPALQGLENGLPT
VREKTRAGSKKCRFPDDLDTNKKLKKASSKGRKSGGGPEAGVPGRPAGGGHRAGSRAHGH
GREAVVAKPKHKRTDYRRWKSSAEISYEEALRRARRGRRENVGLYPAPVPLPYASPYAYV
ASDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESG
GLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV
NT seq 2511 nt   +upstreamnt  +downstreamnt
atgaagccgagtccggccgggacggcgaaggagctggagcctccggcgccggcccgaggc
gagcagcgcacggcggagcccgaggggcgctggcgggagaagggcgaggcagacaccgag
cggcagcgcacccgggagcggcaggaggccacgctggccgggctggcggagctggagtac
ctgcgccagcgccaagagctgctggtcaggggcgccctgcgcggcgccgggggtgcggga
gccgctgcgccccgcgctggggagctactgggggaggcggcgcagcgcagtcgcctggag
gagaagttcttggaggagaacatcttgctgctaagaaagcaattgaactgtttgaggcga
agagatgctggtttgttgaatcagttgcaagagcttgacaagcagataagtgacctgaga
ctggatgtagaaaagacatctgaagagcacctggagacagacagtcggcctagctcaggg
ttttatgagctgagtgatggggcttcaggatccctttccaattcctctaactcggtgttc
agtgagtgtttatccagttgtcattccagcacctgcttttgcagccccttggaggcgacc
ttgagtctctcagatggttgccccaaatctgcagatctcataggattgttggaatataaa
gaaggccactgtgaagaccaggcctcaggggcagtttgccgttccctctccacaccacaa
tttaattcccttgatgtcattgcagatgtgaatcccaagtaccagtgtgatctggtgtct
aaaaacgggaatgatgtatatcgctatcccagtccacttcatgctgtggctgtgcagagc
ccaatgtttctcctttgtctgacgggcaaccctctgagggaagaggacaggcttggaaac
catgccagtgacatttgcggtggatctgagctagatgccgtcaaaacagacagttcctta
ccgtccccaagcagtctgtggtctgcttcccatccttcatccagcaagaaaatggatggc
tacattctgagcctggtccagaaaaaaacacaccctgtaaggaccaacaaaccaagaacc
agcgtgaacgctgaccccacgaaagggcttctgaggaacgggagcgtttgtgtcagagcc
ccgggcggtgtctcacagggcaacagtgtgaaccttaagaattcgaaacaggcgtgtctg
ccctctggcgggataccttctctgaacaatgggacattctccccaccgaagcagtggtcg
aaagaatcaaaggccgaacaagccgaaagcaagagggtgcccctgccagagggctgcccc
tcaggcgctgcctccgaccttcagagtaagcacctgccaaaaacggccaagccagcctcg
caagaacatgctcggtgttccgccattgggacaggggagtcccctaaggaaagcgctcag
ctctcaggggcctctccaaaagagagtcctagcagaggccctgccccgccgcaggagaac
aaagttgtacagcccctgaaaaagatgtcacagaaaaacagcctgcagggcgtccccccg
gccactcctcccctgctgtctacagctttccccgtggaagagaggcctgccttggatttc
aagagcgagggctcttcccaaagcctggaggaagcgcacctggtcaaggcccagtttatc
ccggggcagcagcccagtgtcaggctccaccggggccacaggaacatgggcgtcgtgaag
aactccagcctgaagcaccgcggcccagccctccaggggctggagaacggcttgcccacc
gtcagggagaaaacgcgggccgggagcaagaagtgtcgcttcccagatgacttggataca
aataagaaactcaagaaagcctcctccaaggggaggaagagtgggggcgggcccgaggct
ggtgttcccggcaggcccgcgggcgggggccacagggcggggagcagggcgcatggccac
ggacgggaggcggtggtggccaaacctaagcacaagcgaactgactaccggcggtggaag
tcctcggccgagatttcctacgaagaggccctgaggagggcccggcgcggtcgccgggag
aatgtggggctgtaccccgcgcctgtgcctctgccctacgccagcccctacgcctacgtg
gctagcgactccgagtactcggccgagtgcgagtccctgttccactccaccgtggtggac
accagtgaggacgagcagagcaattacaccaccaactgcttcggggacagcgagtcgagt
gtgagcgagggcgagttcgtgggggagagcacaaccaccagcgactctgaagaaagcggg
ggcttaatttggtcccagtttgtccagactctgcccattcaaacggtaacggccccagac
cttcacaaccaccccgcaaaaacctttgtcaaaattaaggcctcacataacctcaagaag
aagatcctccgctttcggtctggctctttgaaactgatgacgacggtttga

DBGET integrated database retrieval system