KEGG   Homo sapiens (human): 5134Help
Entry
5134              CDS       T01001                                 

Gene name
PDCD2, RP8, ZMYND7
Definition
(RefSeq) programmed cell death 2
  KO
K14801  pre-rRNA-processing protein TSR4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    5134 (PDCD2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    5134 (PDCD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDCD2_C zf-MYND
Motif
Other DBs
NCBI-GeneID: 5134
NCBI-ProteinID: NP_002589
OMIM: 600866
HGNC: 8762
Ensembl: ENSG00000071994
Vega: OTTHUMG00000016083
Pharos: Q16342(Tbio)
UniProt: Q16342
Position
6q27
AA seq 344 aa AA seqDB search
MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSF
LLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPET
GESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDH
IIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGEALEEELDSMAKHESREDKI
FQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNY
LKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgccggggccaggcctgtggagctgggcttcgccgagtcggcgccggcgtgg
cgactgcgcagcgagcagttccccagcaaggtgggcgggcggccggcatggctgggcgcg
gccgggctgccggggccccaggccctggcctgcgagctgtgcggccgcccgctctccttc
ctgctgcaggtgtatgcgccgctgcctggccgcccggacgccttccaccgctgcatcttc
ctcttctgctgccgcgagcagccgtgctgtgccggcctgcgagtttttaggaatcaacta
cccaggaaaaacgatttttactcatatgagccaccttctgagaatcctcccccagaaaca
ggagaatcagtgtgtctccagcttaagtctggtgctcatctctgcagggtttgtggctgt
ttaggccccaaaacgtgctccagatgccacaaagcatattactgcagcaaggagcatcag
accctagactggagattgggacataagcaggcttgtgcacaaccagatcatctggaccat
ataattccagaccacaacttcctttttccagaatttgaaattgtaatagaaacagaagat
gagattatgcctgaggttgtggaaaaggaagattactcagagattatagggagcatgggt
gaagcacttgaggaagaactggattccatggcaaaacatgaatccagggaagataaaatt
tttcagaagtttaaaactcagatagcccttgaaccagaacagattcttagatatggcaga
ggtattgcccccatctggatttctggtgaaaatattcctcaagaaaaggatattccagat
tgcccctgtggtgccaagagaatattggaattccaggtcatgcctcagctcctaaactac
ctgaaggctgacagactgggcaagagcattgactggggcatcctggctgtcttcacctgt
gctgagagctgcagcttgggtactggctatacagaagaatttgtgtggaagcaggatgta
acagatacaccgtaa

DBGET integrated database retrieval system