KEGG   Homo sapiens (human): 51341Help
Entry
51341             CDS       T01001                                 

Gene name
ZBTB7A, FBI-1, FBI1, LRF, TIP21, ZBTB7, ZNF857A, pokemon
Definition
(RefSeq) zinc finger and BTB domain containing 7A
  KO
K10494  zinc finger and BTB domain-containing protein 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    51341 (ZBTB7A)
   04121 Ubiquitin system [BR:hsa04121]
    51341 (ZBTB7A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    51341 (ZBTB7A)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     51341 (ZBTB7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_11 zf-met DUF3268
Motif
Other DBs
NCBI-GeneID: 51341
NCBI-ProteinID: NP_001304919
OMIM: 605878
HGNC: 18078
Ensembl: ENSG00000178951
Vega: OTTHUMG00000181792
Pharos: O95365(Tbio)
UniProt: O95365
Structure
PDB: 

Position
19p13.3
AA seq 584 aa AA seqDB search
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFK
KLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVS
HVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLPPAAAAAA
ASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPAERPPTGDGDEGDSN
PGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGA
AEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMDYYLKYFSGAH
DGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFT
RQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKD
EDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggccggcggcgtggacggccccatcgggatcccgttccccgaccacagcagcgacatc
ctgagtgggctgaacgagcagcggacgcagggcctgctgtgcgacgtggtgatcctggtg
gagggccgcgagttccccacgcaccgctcggtgctggccgcctgcagccagtacttcaag
aagctgttcacgtcgggcgccgtggtggaccagcagaacgtgtacgagatcgacttcgtc
agcgccgaggcgctcaccgcgctcatggacttcgcctacacggccacgctcaccgtcagc
acagccaacgtgggtgacatcctcagcgccgcccgcctgctggagatccccgccgtgagc
cacgtgtgcgccgacctcctggaccggcagatcctggcggccgacgcgggcgccgacgcc
gggcagctggaccttgtagatcaaattgatcagcgcaacctcctccgcgccaaggagtac
ctcgagttcttccagagcaaccccatgaacagcctgccccccgcggccgccgccgccgct
gccagcttcccgtggtccgcctttggggcgtccgatgatgacctggatgccaccaaggag
gccgtggccgccgctgtggccgccgtggccgcgggcgactgcaacggcttagacttctat
gggccgggccccccggccgagcggcccccgacgggggacggggacgagggcgacagcaac
ccgggtctgtggccagagcgggatgaggacgcccccaccgggggtctctttccgccgccg
gtggccccgccggccgccacgcagaacggccactacggccgcggcggagaggaggaggcc
gcctcgctgtcggaggcggcccccgagccgggcgactctccgggcttcctgtcgggagcg
gccgagggcgaggacggggacgggcccgacgtggacgggctggcggccagcacgctgctg
cagcagatgatgtcatcggtgggccgggcgggggccgcggcgggggacagcgacgaggag
tcgcgggccgacgacaagggcgtcatggactactacctgaagtacttcagcggcgcccac
gacggcgacgtctacccggcctggtcgcagaaggtggagaagaagatccgagccaaggcc
ttccagaagtgccccatctgcgagaaggtcatccagggcgccggcaagctgccgcgacac
atccgcacccacacgggcgagaagccctacgagtgcaacatctgcaaggtccgcttcacc
aggcaggacaagctgaaggtgcacatgcggaagcacacgggcgagaagccgtacctgtgc
cagcagtgcggcgccgcctttgcccacaactacgacctgaagaaccacatgcgcgtgcac
acgggcctgcgcccctaccagtgcgacagctgctgcaagaccttcgtccgctccgaccac
ctgcacagacacctcaagaaagacggctgcaacggcgtcccctcgcgccgcggccgcaag
ccccgcgtccggggcggggcgcccgaccccagcccgggggccaccgcgacccccggcgcc
cccgcccagcccagctcccccgacgcccggcgcaacggccaggagaagcactttaaggac
gaggacgaggacgaggacgtggccagccccgacggcttgggccggttgaatgtagcgggc
gccggtggaggaggtgacagcggaggtggccccggggccgccaccgacggtaacttcaca
gccggactcgcctaa

DBGET integrated database retrieval system