KEGG   Homo sapiens (human): 51347Help
Entry
51347             CDS       T01001                                 

Gene name
TAOK3, DPK, JIK, MAP3K18, hKFC-A
Definition
(RefSeq) TAO kinase 3
  KO
K04429  thousand and one amino acid protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    51347 (TAOK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    51347 (TAOK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     51347 (TAOK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   51347 (TAOK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 51347
NCBI-ProteinID: NP_001333417
OMIM: 616711
HGNC: 18133
Ensembl: ENSG00000135090
Vega: OTTHUMG00000168875
Pharos: Q9H2K8(Tbio)
UniProt: Q9H2K8
Position
12q24.23
AA seq 898 aa AA seqDB search
MRKGVLKDPEIADLFYKDDPEELFIGLHEIGHGSFGAVYFATNAHTSEVVAIKKMSYSGK
QTHEKWQDILKEVKFLRQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQ
EVEIAAITHGALHGLAYLHSHALIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVG
TPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPT
LQSNEWTDSFRRFVDYCLQKIPQERPTSAELLRHDFVRRDRPLRVLIDLIQRTKDAVREL
DNLQYRKMKKILFQETRNGPLNESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVSTGSQ
SSSVNSMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQ
SVQSQALHYRNRERFATIKSASLVTRQIHEHEQENELREQMSGYKRMRRQHQKQLIALEN
KLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVAIIEKEAKVAAADEKKFQQQILAQ
QKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHL
LTQQRLYYDKNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELE
YRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIK
KQFQDTCKVQTKQYKALKNHQLEVTPKNEHKTILKTLKDEQTRKLAILAEQYEQSINEMM
ASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRA
HLEQKIEEELAALQKERSERIKNLLERQEREIETFDMESLRMGFGNLVTLDFPKEDYR
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaggggtgctgaaggacccagagattgccgatctattctacaaagatgatcct
gaggaactttttattggtttgcatgaaattggacatggaagttttggagcagtttatttt
gctacaaatgctcacaccagtgaggtggtggcaattaagaagatgtcctatagtgggaag
cagacccatgagaaatggcaagatattcttaaggaagttaaatttttacgacaattgaag
catcctaatactattgagtacaaaggctgttacttgaaagaacacactgcttggttggtg
atggaatattgcttaggctcagcctctgatttattagaagttcataaaaaaccacttcag
gaagtggagatcgctgccattactcatggagccttgcatggactagcctacctacattct
catgcattgattcatagggatattaaagcaggaaatattcttctaacagagccaggtcag
gtaaaactagctgattttggatctgcttcaatggcttctcctgccaactccttcgtgggc
acaccttactggatggctccagaggtgatcttagctatggatgaaggacagtatgatggg
aaagttgatatttggtcacttggcatcacttgtattgaattggcggaacggaagccgccc
cttttcaacatgaatgcaatgagtgccttatatcacattgcccagaatgactccccaacg
ttacagtctaatgaatggacagactcctttaggagatttgttgattactgcttgcagaaa
atacctcaggaaaggccaacatcagcagaactattaaggcatgactttgttcgacgagac
cggccactacgtgtcctcattgacctcatacagaggacaaaagatgcagttcgtgagcta
gataacctacagtaccgaaaaatgaaaaaaatacttttccaagagacacggaatggaccc
ttgaatgagtcacaggaggatgaggaagacagtgaacatggaaccagcctgaacagggaa
atggacagcctgggcagcaaccattccattccaagcatgtccgtgagcacaggcagccag
agcagcagtgtgaacagcatgcaggaagtcatggacgagagcagttccgaacttgtcatg
atgcacgatgacgaaagcacaatcaattccagctcctccgtcgtgcataagaaagatcat
gtattcataagggatgaggcgggccacggcgatcccaggcctgagccgcggcctacccag
tcagttcagagccaggccctccactaccggaacagagagcgctttgccacgatcaaatca
gcatctttggttacacgacagatccatgagcatgagcaggagaacgagttgcgggaacag
atgtcaggttataagcggatgcggcgccagcaccagaagcagctgatcgccctggagaac
aagctgaaggctgagatggacgagcaccgcctcaagctacagaaggaggtggagacgcat
gccaacaactcgtccatcgagctggagaagctggccaagaagcaagtggctatcatagaa
aaggaggcaaaggtagctgcagcagatgagaagaagttccagcaacagatcttggcccag
cagaagaaagatttgacaactttcttagaaagtcagaagaagcagtataagatttgtaag
gaaaaaataaaagaggaaatgaatgaggaccatagcacacccaagaaagagaagcaagag
cggatctccaaacataaagagaacttgcagcacacacaggctgaagaggaagcccacctt
ctcactcaacagagactgtactacgacaaaaattgtcgtttcttcaagcggaaaataatg
atcaagcggcacgaggtggagcagcagaacattcgggaggaactaaataaaaagaggacc
cagaaggagatggagcatgccatgctaatccggcacgacgagtccacccgagagctagag
tacaggcagctgcacacgttacagaagctacgcatggatctgatccgtttacagcaccag
acggaactggaaaaccagctggagtacaataagaggcgagaaagagaactgcacagaaag
catgtcatggaacttcggcaacagccaaaaaacttaaaggccatggaaatgcaaattaaa
aaacagtttcaggacacttgcaaagtacagaccaaacagtataaagcactcaagaatcac
cagttggaagttactccaaagaatgagcacaaaacaatcttaaagacactgaaagatgag
cagacaagaaaacttgccattttggcagagcagtatgaacagagtataaatgaaatgatg
gcctctcaagcgttacggctagatgaggctcaagaagcagaatgccaggccttgaggcta
cagctccagcaggaaatggagctgctcaacgcctaccagagcaaaatcaagatgcaaaca
gaggcacaacatgaacgtgagctccagaagctagagcagagagtgtctctgcgcagagca
caccttgagcagaagattgaagaggagctggctgcccttcagaaggaacgcagcgagaga
ataaagaacctattggaaaggcaagagcgagagattgaaacttttgacatggagagcctc
agaatgggatttgggaatttggttacattagattttcctaaggaggactacagatga

KEGG   Homo sapiens (human): 57551Help
Entry
57551             CDS       T01001                                 

Gene name
TAOK1, KFC-B, MAP3K16, MARKK, PSK-2, PSK2, TAO1, hKFC-B, hTAOK1
Definition
(RefSeq) TAO kinase 1
  KO
K04429  thousand and one amino acid protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    57551 (TAOK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    57551 (TAOK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     57551 (TAOK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   57551 (TAOK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 57551
NCBI-ProteinID: NP_065842
OMIM: 610266
HGNC: 29259
Ensembl: ENSG00000160551
Vega: OTTHUMG00000179718
Pharos: Q7L7X3(Tbio)
UniProt: Q7L7X3 A0A024QZ70
Position
17q11.2
AA seq 1001 aa AA seqDB search
MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMS
YSGKQSTEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHK
KPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPAN
SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQN
ESPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIFVLRERPETVLIDLIQRTKDA
VRELDNLQYRKMKKLLFQEAHNGPAVEAQEEEEEQDHGVGRTGTVNSVGSNQSIPSMSIS
ASSQSSSVNSLPDVSDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQ
SPPQVSRHKSHYRNREHFATIRTASLVTRQMQEHEQDSELREQMSGYKRMRRQHQKQLMT
LENKLKAEMDEHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKEAKVMSNEEKKFQQHI
QAQQKKELNSFLESQKREYKLRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEE
ANLLRRQRQYLELECRRFKRRMLLGRHNLEQDLVREELNKRQTQKDLEHAMLLRQHESMQ
ELEFRHLNTIQKMRCELIRLQHQTELTNQLEYNKRRERELRRKHVMEVRQQPKSLKSKEL
QIKKQFQDTCKIQTRQYKALRNHLLETTPKSEHKAVLKRLKEEQTRKLAILAEQYDHSIN
EMLSTQALRLDEAQEAECQVLKMQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSL
RRALLEQKIEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAF
SHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSM
GVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaactaacagagcaggcagcctgaaggaccctgaaattgcagagctcttcttc
aaagaagatccagagaagctcttcacagatctcagagaaattggccatggaagctttgga
gcagtgtattttgcacgagatgtgcgtaccaatgaagtggtggccatcaagaaaatgtct
tatagtggaaagcagtctactgagaaatggcaggatattattaaggaagtcaagtttcta
caaagaataaaacatcccaacagtatagaatacaaaggctgttatttacgtgaacacaca
gcatggcttgtaatggaatattgtttaggatctgcttcggatttactagaagttcacaaa
aagccattacaagaagtggaaatagcagcaattacacatggtgctcttcagggattagcc
tacttacattctcatactatgattcatagagatatcaaagcaggaaatatccttctgaca
gaaccaggccaggtgaaacttgctgactttggctctgcttccatggcatcacctgccaat
tcctttgtgggaacgccgtattggatggccccagaagtaattttagccatggatgaagga
caatatgatggcaaagtagatgtgtggtctcttggaataacatgtattgaactagcggaa
aggaagcctcctttatttaatatgaatgcaatgagtgccttatatcacatagcccaaaat
gaatcccctacactacagtctaatgaatggtctgattattttcgcaactttgtagattct
tgcctccagaaaatccctcaagatcgacctacatcagaggaacttttaaagcacatattt
gttcttcgggagcgccctgaaaccgtgttaatagatctcattcagaggacaaaggatgca
gtaagagagctggacaatctgcagtatcgaaagatgaagaaactccttttccaggaggca
cataatggaccagcagtagaagcacaggaagaagaagaggaacaagatcatggtgttggc
cggacaggaacagttaatagtgttggaagtaatcaatccattcccagcatgtccatcagt
gccagcagccaaagcagtagtgttaacagtcttccagatgtctcagatgacaagagtgag
ctagacatgatggagggagaccacacagtgatgtctaacagttctgttatccatttaaaa
ccagaggaagaaaattacagagaagagggagatcctagaacaagagcatcagatccacaa
tctccaccccaagtatctcgtcacaaatcacactatcgtaatcgagaacactttgctact
atacggacagcatcactggttacgaggcaaatgcaagaacatgagcaggactctgagctt
agagaacaaatgtctggctataagcgaatgaggcgacaacatcaaaagcaactgatgact
ctggaaaacaagctaaaggctgagatggatgaacatcgcctcagattagacaaagatctt
gaaactcagcgtaacaattttgctgcagaaatggagaaacttatcaagaaacaccaggct
gccatggagaaagaggctaaagtgatgtccaatgaagagaaaaaatttcagcaacatatt
caggcccaacagaagaaagaactgaatagttttctcgagtcccagaaaagagagtataaa
cttcgaaaagagcagcttaaagaggagctaaatgaaaaccagagtacccccaaaaaagaa
aaacaggagtggctttcaaagcagaaggagaatatacagcatttccaagcagaagaagaa
gctaaccttcttcgacgtcaaagacaatacctagagctggaatgccgtcgcttcaagaga
agaatgttacttgggcgtcataacttagagcaggaccttgtcagggaggagttaaacaaa
agacagactcagaaggacttagagcatgccatgctactccgacagcatgaatctatgcaa
gaactggagttccgccacctcaacacaattcagaagatgcgctgtgagttgatcagatta
cagcatcaaactgagctcactaaccagctggaatataataagcgaagagaacgagaacta
agacgaaagcatgtcatggaagttcgacaacagcctaagagtttgaagtctaaagaactc
caaataaaaaagcagtttcaggatacctgcaaaatccaaaccagacagtacaaagcatta
agaaatcacctgctggagactacaccaaagagtgagcacaaagctgttctgaaacggctc
aaggaggaacagacccggaaattagctatcttggctgagcagtatgatcacagcattaat
gaaatgctctccacacaagccctgcgtttggatgaagcacaggaagcagagtgccaggtt
ttgaagatgcagctgcagcaggaactggagctgttgaatgcgtatcagagcaaaatcaag
atgcaagctgaggcacaacatgatcgagagcttcgcgagcttgaacagagggtctccctc
cggagggcactcttagaacaaaagattgaagaagagatgttggctttgcagaatgagcgc
acagaacgaatacgaagcctgttggaacgtcaagccagagagattgaagcttttgactct
gaaagcatgagactaggttttagtaatatggtcctttctaatctctcccctgaggcattc
agccacagctacccgggagcttctggttggtcacacaaccctactgggggtccaggacct
cactggggtcatcccatgggtggcccaccacaagcttggggccatccaatgcaaggtgga
ccccagccatggggtcacccttcagggccaatgcaaggggtacctcgaggtagcagtatg
ggagtccgcaatagcccccaggctctgaggcggacagcttctgggggacggacggagcag
ggcatgagcagaagcacgagtgtcacttcacaaatatccaatgggtcacacatgtcttat
acataa

KEGG   Homo sapiens (human): 9344Help
Entry
9344              CDS       T01001                                 

Gene name
TAOK2, MAP3K17, PSK, PSK1, PSK1-BETA, TAO1, TAO2
Definition
(RefSeq) TAO kinase 2
  KO
K04429  thousand and one amino acid protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    9344 (TAOK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9344 (TAOK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9344 (TAOK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   9344 (TAOK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like RIO1
Motif
Other DBs
NCBI-GeneID: 9344
NCBI-ProteinID: NP_057235
OMIM: 613199
HGNC: 16835
Ensembl: ENSG00000149930
Vega: OTTHUMG00000132111
Pharos: Q9UL54(Tbio)
UniProt: Q9UL54
Position
16p11.2
AA seq 1235 aa AA seqDB search
MPAGGRAGSLKDPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMS
YSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHK
KPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPAN
SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQN
ESPVLQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDA
VRELDNLQYRKMKKILFQEAPNGPGAEAPEEEEEAEPYMHRAGTLTSLESSHSVPSMSIS
ASSQSSSVNSLADASDNEEEEEEEEEEEEEEEGPEAREMAMMQEGEHTVTSHSSIIHRLP
GSDNLYDDPYQPEITPSPLQPPAAPAPTSTTSSARRRAYCRNRDHFATIRTASLVSRQIQ
EHEQDSALREQLSGYKRMRRQHQKQLLALESRLRGEREEHSARLQRELEAQRAGFGAEAE
KLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKEELQE
NPSTPKREKAEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQD
LLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEY
NKRREQELRQKHAAQVRQQPKSLKVRAGQRPPGLPLPIPGALGPPNTGTPIEQQPCSPGQ
EAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPSPSPQKHGSLVDEEVW
GLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPE
EEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVG
SSSGLLPLLLLLLLPLLAAQGGGGLQAALLALEVGLVGLGASYLLLCTALHLPSSLFLLL
AQGTALGAVLGLSWRRGLMGVPLGLGAAWLLAWPGLALPLVAMAAGGRWVRQQGPRVRRG
ISRLWLRVLLRLSPMAFRALQGCGAVGDRGLFALYPKTNKDGFRSRLPVPGPRRRNPRTT
QHPLALLARVWVLCKGWNWRLARASQGLASHLPPWAIHTLASWGLLRGERPTRIPRLLPR
SQRQLGPPASRQPLPGTLAGRRSRTRQSRALPPWR
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgggggccgggccgggagcctgaaggacccagatgtggctgagctcttcttc
aaggatgacccagaaaagctcttctctgacctccgggaaattggccatggcagctttgga
gccgtatactttgcccgggatgtccggaatagtgaggtggtggccatcaagaagatgtcc
tacagtgggaagcagtccaatgagaaatggcaagacatcatcaaggaggtgcggttctta
cagaagctccggcatcccaacaccattcagtaccggggctgttacctgagggagcacacg
gcttggctggtaatggagtattgcctgggctcagcttctgaccttctagaagtgcacaag
aaaccccttcaggaggtagagatcgcagctgtgacccacggggcgcttcagggcctggca
tatctgcactcccacaacatgatccatagggatgtgaaggctggaaacatcctgctgtca
gagccagggttagtgaagctaggggactttggttctgcgtccatcatggcacctgccaac
tccttcgtgggcaccccatactggatggcacccgaggtgatcctggccatggatgagggg
cagtacgatggcaaagtggacgtctggtccttggggataacctgcatcgagctggctgaa
cggaaaccaccgctctttaacatgaatgcgatgagtgccttataccacattgcacagaac
gaatcccccgtgctccagtcaggacactggtctgagtacttccggaattttgtcgactcc
tgtcttcagaaaatccctcaagacagaccaacctcagaggttctcctgaagcaccgcttt
gtgctccgggagcggccacccacagtcatcatggacctgatccagaggaccaaggatgcc
gtgcgggagctggacaacctgcagtaccgcaagatgaagaagatcctgttccaagaggca
cccaacggccctggtgccgaggccccagaggaggaagaggaggccgagccctacatgcac
cgggccgggactctgaccagcctcgagagtagccactcagtgcccagcatgtccatcagc
gcctccagccagagcagctccgtcaacagcctagcagatgcctcagacaacgaggaagag
gaggaggaggaggaggaagaggaggaggaggaagaaggccctgaagcccgggagatggcc
atgatgcaggagggggagcacacagtcacctctcacagctccattatccaccggctgccg
ggctctgacaacctatatgatgacccctaccagccagagataacccccagccctctccag
ccgcctgcagccccagctcccacttccaccacctcttccgcccgccgccgggcctactgc
cgtaaccgagaccactttgccaccatccgaaccgcctccctggtcagccgtcagatccag
gagcatgagcaggactctgcgctgcgggagcagctgagcggctataagcggatgcgacga
cagcaccagaagcagctgctggccctggagtcacggctgaggggtgaacgggaggagcac
agtgcacggctgcagcgggagcttgaggcgcagcgggctggctttggggcagaggcagaa
aagctggcccggcggcaccaggccataggtgagaaggaggcacgagctgcccaggccgag
gagcggaagttccagcagcacatccttgggcagcagaagaaggagctggctgccctgctg
gaggcacagaagcggacctacaaacttcgcaaggaacagctgaaggaggagctccaggag
aaccccagcactcccaagcgggagaaggccgagtggctgctgcggcagaaggagcagctc
cagcagtgccaggcggaggaggaagcagggctgctgcggcggcagcgccagtactttgag
ctgcagtgtcgccagtacaagcgcaagatgttgctggctcggcacagcctggaccaggac
ctgctgcgggaggacctgaacaagaagcagacccagaaggacttggagtgtgcactgctg
cttcggcagcacgaggccacgcgggagctggagctgcggcagctccaggccgtgcagcgc
acgcgggctgagctcacccgcctgcagcaccagacggagctgggcaaccagctggagtac
aacaagcggcgtgagcaagagttgcggcagaagcatgcggcccaggttcgccagcagccc
aagagcctcaaagtacgtgcaggccagcgccccccgggccttccactccccattcctggg
gctctgggcccacccaacacaggcacccctatagaacagcagccctgctcacctggccag
gaggcagtcctggaccaaagaatgcttggcgaggaggaggaagcagttggagagagaagg
attctgggaaaggaaggggccactttggagcccaagcagcagaggattctgggggaagaa
tcaggagcccctagtcccagtccacaaaaacatgggagcctggttgatgaggaagtttgg
ggtctgcctgaggagatagaggagcttagggtgccctcccttgtaccccaggagaggagc
attgttggccaggaggaggctgggacatggagcttgtgggggaaggaggatgagagtctt
ctggatgaggagtttgagcttggctgggtccagggcccagcactgactcccgtccctgag
gaggaggaagaagaggaagagggggctccgattgggacccctagggatcctggagatggt
tgtccttcccccgacatccctcctgaaccccctccaacacacctgaggccctgccctgcc
agccagctccctggactcctgtcccatggcctcctggccggcctctcctttgcagtgggg
tcctcctctggcctcctgcccctcctgctgctgctgctgcttccattgctggcagcccag
ggtgggggtggcctgcaggcagcgctgctggcccttgaggtggggctggtgggtctgggg
gcctcctacctgctcctttgtacagccctgcacctgccctccagtcttttcctactcctg
gcccagggtaccgcactgggggccgtcctgggcctgagctggcgccgaggcctcatgggt
gttcccctgggccttggagctgcctggctcttagcttggccaggcctagctctacctctg
gtggctatggcagcggggggcagatgggtgcggcagcagggcccccgggtgcgccggggc
atatctcgactctggttgcgggttctgctgcgcctgtcacccatggccttccgggccctg
cagggctgtggggctgtgggggaccggggtctgtttgcactgtaccccaaaaccaacaag
gatggcttccgcagccgcctgcccgtccctgggccccggcggcgtaatccccgcaccacc
caacacccattagctctgttggcaagggtctgggtcctgtgcaagggctggaactggcgt
ctggcacgggccagccagggtttagcatcccacttgcccccgtgggccatccacacactg
gccagctggggcctgcttcggggtgaacggcccacccgaatcccccggctactaccacgc
agccagcgccagctagggccccctgcctcccgccagccactgccagggactctagccggg
cggaggtcacgcacccgccagtcccgggccctgcccccctggaggtag

DBGET integrated database retrieval system