KEGG   Homo sapiens (human): 51350Help
Entry
51350             CDS       T01001                                 

Gene name
KRT76, HUMCYT2A, KRT2B, KRT2P
Definition
(RefSeq) keratin 76
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    51350 (KRT76)
   04147 Exosome [BR:hsa04147]
    51350 (KRT76)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     51350 (KRT76)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   51350 (KRT76)
  Exosomal proteins of other body fluids (saliva and urine)
   51350 (KRT76)
  Exosomal proteins of colorectal cancer cells
   51350 (KRT76)
  Exosomal proteins of bladder cancer cells
   51350 (KRT76)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip TPR_MLP1_2 Spc7 ATG16 Jnk-SapK_ap_N TSNAXIP1_N ADIP Alanine_zipper APG6_N Rootletin DUF948 ZapB
Motif
Other DBs
NCBI-GeneID: 51350
NCBI-ProteinID: NP_056932
OMIM: 616671
HGNC: 24430
Ensembl: ENSG00000185069
Vega: OTTHUMG00000169797
Pharos: Q01546(Tdark)
UniProt: Q01546
Position
12q13.13
AA seq 638 aa AA seqDB search
MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGAGSFGSRSLYN
LGSNKSISISVAAGSSRAGGFGGGRSSCGFAGGYGGGFGGSYGGGFGGGRGVGSGFGGAG
GFGGAGGFGGPGVFGGPGSFGGPGGFGPGGFPGGIQEVIVNQSLLQPLNVEIDPQIGQVK
AQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWELLQQQTTGSGPSSLEPCFESYISF
LCKQLDSLLGERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAENEFVGLKKDVDAAFMN
KVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDLGSIIAEVRAQ
YEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSEIMELNRMIQRLRAEIENVKK
QNANLQTAIAEAEQRGEMALKDANAKLQDLQTALQKAKDDLARLLRDYQELMNVKLALDV
EIATYRKLLEGEECRMSGECQSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGG
SSSSSSSGYGVSGGSGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGS
SSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacaagtttgcaagaaatccttcagtggcaggagccagggtttctctggccgc
tctgctgtggtctccggcagcagcaggatgagctgtgtggcccgctctgggggagctggt
ggaggggcctgtggcttcaggagcggagcaggcagctttggcagtcgcagcctctacaac
ctgggcagcaacaagagcatctccatcagcgtggcagctggcagctcccgggctggaggc
tttgggggagggcggagcagctgtggctttgcaggtggctatggaggtggctttgggggc
agctatggtggtggctttggtggtggcagaggagtaggtagtggttttggaggggctggt
ggctttggtggagctggtggctttggtggtcctggtgtatttggtgggcctggcagcttt
ggtggtcctggtggctttggccctgggggctttcctgggggaattcaggaagtgattgta
aaccagagtctcctgcagcccctcaatgtggagatcgacccccagattgggcaagtaaag
gcccaggagcgggaacagatcaagaccctcaacaacaagtttgcctccttcatcgacaag
gtgcggttcctggaacagcagaacaaggtcctggagaccaagtgggaactgctccagcag
cagaccacaggctcagggcccagcagcctggagccttgttttgaatcctacatcagcttc
ctatgcaagcagctagattcacttctaggggagagggggaacctggagggagagctgaaa
agcatgcaggacctggtggaagacttcaaaaagaagtatgaagatgaaatcaacaaacgc
actgccgcagagaatgagtttgtggggctcaagaaggatgtggatgcggctttcatgaac
aaggtggagctgcaggccaaagtggacagcctgacagatgaagtcagcttcctgaggacc
ctctatgagatggagctgtcccagatgcaaagccatgccagtgacacgtctgtggttctg
tccatggacaacaaccgctgcctggacctgggcagcatcattgccgaggtccgcgcccag
tatgaggagattgcccagaggagcaagtctgaagctgaggccctgtaccagaccaagctt
ggggagctgcagaccacagctggcaggcatggggatgacctgaggaacaccaagagtgag
atcatggagctcaacaggatgatccagaggctacgggctgagattgaaaatgtcaagaag
cagaatgccaacctgcagacggcaattgcagaggctgagcagcgtggagagatggccctc
aaggacgccaatgccaagctccaagacttgcagactgccctacagaaggctaaggatgac
ctggctcggctcctgcgtgactaccaggagctgatgaacgtcaagctggccctggatgtg
gagattgccacctaccgcaagctgctggagggagaggagtgcaggatgtctggagaatgt
cagagtgccgtgtgcatttcagtggtcagcaatgtcaccagcacaagtggcagctctggc
agtagccgtggagtttttggaggggtcagtggcagtggcagtggtggctacaaaggcggc
agcagcagcagcagcagcagtggctatggagtcagtggcggcagcggcagtggctatgga
ggggtcagcagtggcagcactgggggcaggggtagcagcgggagctaccagagcagcagt
agtgggagcaggctcggcggtgcaggtagcatctccgtgagccacagtggaatgggctcc
agctctggcagcatccagacttctggaggaagtggctacaagtctggtggtggaggcagc
accagtatccgcttctcccagaccacgagctcaagccagcatagctccaccaagtga

DBGET integrated database retrieval system