KEGG   Homo sapiens (human): 5136Help
Entry
5136              CDS       T01001                                 

Gene name
PDE1A, CAM-PDE_1A, CAM-PDE-1A, HCAM-1, HCAM1, HSPDE1A
Definition
(RefSeq) phosphodiesterase 1A
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Choline theophyllinate: D02017
Diprophylline: D00691
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5136 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5136 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5136 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    5136 (PDE1A)
   04742 Taste transduction
    5136 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5136 (PDE1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5136 (PDE1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 5136
NCBI-ProteinID: NP_001003683
OMIM: 171890
HGNC: 8774
Ensembl: ENSG00000115252
Vega: OTTHUMG00000132596
Pharos: P54750(Tclin)
UniProt: P54750
Position
2q32.1
AA seq 535 aa AA seqDB search
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggggtctagtgccacagagattgaagaattggaaaacaccacttttaagtatcttaca
ggagaacagactgaaaaaatgtggcagcgcctgaaaggaatactaagatgcttggtgaag
cagctggaaagaggtgatgttaacgtcgtcgacttaaagaagaatattgaatatgcggca
tctgtgctggaagcagtttatatcgatgaaacaagaagacttctggatactgaagatgag
ctcagtgacattcagactgactcagtcccatctgaagtccgggactggttggcttctacc
tttacacggaaaatggggatgacaaaaaagaaacctgaggaaaaaccaaaatttcggagc
attgtgcatgctgttcaagctggaatttttgtggaaagaatgtaccgaaaaacatatcat
atggttggtttggcatatccagcagctgtcatcgtaacattaaaggatgttgataaatgg
tctttcgatgtatttgccctaaatgaagcaagtggagagcatagtctgaagtttatgatt
tatgaactgtttaccagatatgatcttatcaaccgtttcaagattcctgtttcttgccta
atcacctttgcagaagctttagaagttggttacagcaagtacaaaaatccatatcacaat
ttgattcatgcagctgatgtcactcaaactgtgcattacataatgcttcatacaggtatc
atgcactggctcactgaactggaaattttagcaatggtctttgctgctgccattcatgat
tatgagcatacagggacaacaaacaactttcacattcagacaaggtcagatgttgccatt
ttgtataatgatcgctctgtccttgagaatcaccacgtgagtgcagcttatcgacttatg
caagaagaagaaatgaatatcttgataaatttatccaaagatgactggagggatcttcgg
aacctagtgattgaaatggttttatctacagacatgtcaggtcacttccagcaaattaaa
aatataagaaacagtttgcagcagcctgaagggattgacagagccaaaaccatgtccctg
attctccacgcagcagacatcagccacccagccaaatcctggaagctgcattatcggtgg
accatggccctaatggaggagtttttcctgcagggagataaagaagctgaattagggctt
ccattttccccactttgtgatcggaagtcaaccatggtggcccagtcacaaataggtttc
atcgatttcatagtagagccaacattttctcttctgacagactcaacagagaaaattgtt
attcctcttatagaggaagcctcaaaagccgaaacttcttcctatgtggcaagcagctca
accaccattgtggggttacacattgctgatgcactaagacgatcaaatacaaaaggctcc
atgagtgatgggtcctattccccagactactcccttgcagcagtggacctgaagagtttc
aagaacaacctggtggacatcattcagcagaacaaagagaggtggaaagagttagctgca
caagaagcaagaaccagttcacagaagtgtgagtttattcatcagtaa

KEGG   Homo sapiens (human): 5137Help
Entry
5137              CDS       T01001                                 

Gene name
PDE1C, DFNA74, Hcam3, cam-PDE_1C, hCam-3
Definition
(RefSeq) phosphodiesterase 1C
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Choline theophyllinate: D02017
Diprophylline: D00691
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5137 (PDE1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5137 (PDE1C)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5137 (PDE1C)
  09157 Sensory system
   04740 Olfactory transduction
    5137 (PDE1C)
   04742 Taste transduction
    5137 (PDE1C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5137 (PDE1C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5137 (PDE1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 5137
NCBI-ProteinID: NP_001177986
OMIM: 602987
HGNC: 8776
Ensembl: ENSG00000154678
Vega: OTTHUMG00000023836
Pharos: Q14123(Tclin)
UniProt: Q14123
Position
7p14.3
AA seq 709 aa AA seqDB search
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDGTKQRSHGSPAPSTSSTCRLTLPVIKPPLR
HFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgccaaccaaggagattgaagaatttgagagcaactctctgaaatacctgcaa
ccggaacagatcgagaaaatctggcttcggctccgcgggctgaggaaatataagaaaacg
tcccagagattacggtctttggtcaaacaattagagagaggggaagcttcagtggtagat
cttaagaagaatttggaatatgcagccacagtgcttgaatctgtgtatattgatgaaaca
aggagactcctggatacagaggatgagctcagtgacattcagtcagatgctgtgccttct
gaggtccgagactggctggcctccaccttcacgcggcagatggggatgatgctcaggagg
agcgacgagaagccccggttcaagagcatcgttcacgcagtgcaggctgggatatttgtg
gagagaatgtatagacggacatcaaacatggttggactgagctatccaccagctgttatt
gaggcattaaaggatgtggacaagtggtcctttgacgtcttttccctcaatgaggccagt
ggggatcatgcactgaaatttattttctatgaactactcacacgttatgatctgatcagc
cgtttcaagatccccatttctgcacttgtctcatttgtggaggccctggaagtgggatac
agcaagcacaaaaatccttaccataacttaatgcacgctgccgatgttacacagacagtg
cattacctcctctataagacaggagtggcgaactggctgacggagctggagatctttgct
ataatcttctcagctgccatccatgactacgagcataccggaaccaccaacaatttccac
attcagactcggtctgatccagctattctgtataatgacagatctgtactggagaatcac
catttaagtgcagcttatcgccttctgcaagatgacgaggaaatgaatattttgattaac
ctctcaaaggatgactggagggagtttcgaaccttggtaattgaaatggtgatggccaca
gatatgtcttgtcacttccaacaaatcaaagcaatgaagactgctctgcagcagccagaa
gccattgaaaagccaaaagccttatcccttatgctgcatacagcagatattagccatcca
gcaaaagcatgggacctccatcatcgctggacaatgtcactcctggaggagttcttcaga
cagggtgacagagaagcagagctggggctgcctttttctcctctgtgtgaccgaaagtcc
actatggttgctcagtcacaagtaggtttcattgatttcatcgtggaacccaccttcact
gtgcttacggacatgaccgagaagattgtgagtccattaatcgatgaaacctctcaaact
ggtgggacaggacagaggcgttcgagtttgaatagcatcagctcgtcagatgccaagcga
tcaggtgtcaagacctctggttcagagggaagtgccccgatcaacaattctgtcatctcc
gttgactataagagctttaaagctacttggacggaagtggtgcacatcaatcgggagaga
tggagggccaaggtacccaaagaggagaaggccaagaaggaagcagaggaaaaggctcgc
ctggccgcagaggagcagcaaaaggaaatggaagccaaaagccaggctgaagaaggcgca
tctggcaaagctgagaaaaagacgtctggagaaactaagaatcaagtcaatggaacacgg
gcaaacaaaagtgacaaccctcgtgggaaaaactccaaagccgagaagtcatcaggagaa
cagcaacagaatggtgacttcaaagatggtaaaaataagacagacaagaaggatcactct
aacatcggaaatgattcaaagaaaacagatggcacaaaacagcgttctcacggctcacca
gccccaagcaccagctccacgtgtcgccttacgttgccagtcatcaagcctcctttgcgt
cattttaaacgccctgcttacgcatctagctcctatgcaccttcagtctcaaagaaaact
gatgagcatcctgcaaggtacaagatgctggatcagaggatcaaaatgaaaaagattcag
aacatctcacataactggaacagaaaatag

KEGG   Homo sapiens (human): 5153Help
Entry
5153              CDS       T01001                                 

Gene name
PDE1B, HEL-S-79p, PDE1B1, PDES1B
Definition
(RefSeq) phosphodiesterase 1B
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Diprophylline: D00691
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5153 (PDE1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5153 (PDE1B)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5153 (PDE1B)
  09157 Sensory system
   04740 Olfactory transduction
    5153 (PDE1B)
   04742 Taste transduction
    5153 (PDE1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5153 (PDE1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5153 (PDE1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 5153
NCBI-ProteinID: NP_000915
OMIM: 171891
HGNC: 8775
Ensembl: ENSG00000123360
Vega: OTTHUMG00000169844
Pharos: Q01064(Tclin)
UniProt: Q01064 A0A024RB59
Structure
PDB: 

Position
12q13.2
AA seq 536 aa AA seqDB search
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNL
EYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHAL
RTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSV
FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVS
FRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtccccccgcagtcctccggagatgctggaggagtcggattgcccgtcaccc
ctggagctgaagtcagcccccagcaagaagatgtggattaagcttcggtctctgctgcgc
tacatggtgaagcagttggagaatggggagataaacattgaggagctgaagaaaaatctg
gagtacacagcttctctgctggaagccgtctacatagatgagacacggcaaatcttggac
acggaggacgagctgcaggagctgcggtcagatgccgtgccttcggaggtgcgggactgg
ctggcctccaccttcacccagcaggcccgggccaaaggccgccgagcagaggagaagccc
aagttccgaagcattgtgcacgctgtgcaggctgggatcttcgtggaacggatgttccgg
agaacatacacctctgtgggccccacttactctactgcggttctcaactgtctcaagaac
ctggatctctggtgctttgatgtcttttccttgaaccaggcagcagatgaccatgccctg
aggaccattgtttttgagttgctgactcggcataacctcatcagccgcttcaagattccc
actgtgtttttgatgagtttcctggatgccttggagacaggctatgggaagtacaagaat
ccttaccacaaccagatccacgcagccgatgttacccagacagtccattgcttcttgctc
cgcacagggatggtgcactgcctgtcggagattgagctcctggccatcatctttgctgca
gctatccatgattatgagcacacgggcactaccaacagcttccacatccagaccaagtca
gaatgtgccatcgtgtacaatgatcgttcagtgctggagaatcaccacatcagctctgtt
ttccgattgatgcaggatgatgagatgaacattttcatcaacctcaccaaggatgagttt
gtagaactccgagccctggtcattgagatggtgttggccacagacatgtcctgccatttc
cagcaagtgaagaccatgaagacagccttgcaacagctggagaggattgacaagcccaag
gccctgtctctactgctccatgctgctgacatcagccacccaaccaagcagtggttggtc
cacagccgttggaccaaggccctcatggaggaattcttccgtcagggtgacaaggaggca
gagttgggcctgcccttttctccactctgtgaccgcacttccactctagtggcacagtct
cagatagggttcatcgacttcattgtggagcccacattctctgtgctgactgacgtggca
gagaagagtgttcagcccctggcggatgaggactccaagtctaaaaaccagcccagcttt
cagtggcgccagccctctctggatgtggaagtgggagaccccaaccctgatgtggtcagc
tttcgttccacctgggtcaagcgcattcaggagaataagcagaaatggaaggaacgggca
gcaagtggcatcaccaaccagatgtccattgacgagctgtccccctgtgaagaagaggcc
cccccatcccctgccgaagatgaacacaaccagaatgggaatctggattag

DBGET integrated database retrieval system