KEGG   Homo sapiens (human): 51362
Entry
51362             CDS       T01001                                 

Gene name
CDC40, EHB3, PRP17, PRPF17
Definition
(RefSeq) cell division cycle 40
  KO
K12816  pre-mRNA-processing factor 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    51362 (CDC40)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    51362 (CDC40)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Step II factors
    51362 (CDC40)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 PQQ_2 UPA
Other DBs
NCBI-GeneID: 51362
NCBI-ProteinID: NP_056975
OMIM: 605585
HGNC: 17350
Ensembl: ENSG00000168438
Vega: OTTHUMG00000015358
Pharos: O60508(Tbio)
UniProt: O60508
Structure
PDB: 

Position
6q21
AA seq 579 aa
MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEV
AVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHI
NDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKK
FKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTI
LHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLS
GHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWD
TETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGA
VNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQS
MDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTT
KLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgtcggctgcgattgcagctctggccgcttcctatggttcgggttcagggtccgaatcg
gactcggacagtgagagcagtcggtgtccgctgccagccgccgactccctcatgcacttg
actaaatcgccttcatcaaagccgtctctagcagtggcagtggactcggctccggaggtg
gcagttaaggaagatttggagactggagttcaccttgaccctgccgtcaaagaagttcag
tataatcctacctatgagaccatgtttgctcctgagtttggaccagaaaatccctttagg
acacagcaaatggctgcccctagaaatatgctttctggatatgccgaaccagctcatatc
aatgatttcatgtttgagcagcaaaggagaacttttgcaacatatggttatgcattagac
ccttcattagataatcatcaagtgtctgctaaatatattggttctgtagaagaagctgaa
aaaaatcaaggtttaactgtatttgaaactggtcagaagaaaacagaaaagaggaaaaag
tttaaagaaaatgatgcatccaatattgatggttttttgggaccatgggcaaaatatgtg
gatgaaaaagatgtagccaaaccttcagaagaagagcaaaaagaattggatgaaatcaca
gcaaagaggcagaaaaaaggaaaacaggaagaagagaaacctggggaggagaagacaatc
ttacatgttaaagaaatgtatgactatcaaggcaggtcctatcttcacatacctcaggat
gttggtgttaatctacggtcaactatgccacctgagaagtgttatcttcccaaaaaacaa
attcatgtgtggtctggacacacaaagggcgtcagtgcagtcagattgtttcctctctct
ggccatttattgctgtcttgttccatggactgtaaaattaagctatgggaggtttatgga
gaacggcgctgtctgagaacatttattggtcacagtaaggctgttagggatatctgcttc
aatactgcaggaacacagttcctcagtgcagcctatgacaggtatcttaagctctgggac
actgagacaggacagtgtatatcaagatttacaaaccgaaaagtaccttattgtgtcaaa
ttcaatcctgatgaagataagcaaaatctctttgtggctgggatgtctgataagaagatt
gtgcaatgggacattcgaagtggagaaattgtgcaggaatatgatcggcatttgggagct
gtcaacaccattgtttttgtggatgagaataggagatttgtgagcacatctgatgataaa
agcctaagagtttgggaatgggatatccctgtggatttcaagtacatagcagaacccagt
atgcactcaatgcctgcagtgactttgtctccaaatggaaaatggctagcatgccaatca
atggacaaccaaatcttaatttttggagcacagaacagatttagattaaataagaaaaaa
atttttaagggccatatggtagcaggctatgcttgtcaggtggacttttcaccagacatg
agttatgtgatttcaggagatggaaatggaaaattaaacatttgggactggaagaccaca
aaactctacagtcgatttaaagctcatgataaagtgtgtataggtgcagtgtggcatcct
catgaaacttctaaggtcataacatgtggttgggatggtctcattaaattgtgggattaa

DBGET integrated database retrieval system