KEGG   Homo sapiens (human): 5137Help
Entry
5137              CDS       T01001                                 

Gene name
PDE1C, Hcam3, cam-PDE_1C, hCam-3
Definition
(RefSeq) phosphodiesterase 1C
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa04020  Calcium signaling pathway
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429
Bucladesine (DG00230): D01238 D07546
Choline theophyllinate: D02017
Diprophylline: D00691
Flavoxate (DG00477): D00718 D07961
Moxaverine (DG00045): D07089 D08238
Papaverine (DG00043): D02218 D07425 D07439
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5137 (PDE1C)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5137 (PDE1C)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    5137 (PDE1C)
  Sensory system
   04740 Olfactory transduction
    5137 (PDE1C)
   04742 Taste transduction
    5137 (PDE1C)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5137 (PDE1C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5137 (PDE1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 5137
NCBI-ProteinID: NP_001177986
OMIM: 602987
HGNC: 8776
Ensembl: ENSG00000154678
Vega: OTTHUMG00000023836
Pharos: Q14123(Tclin)
UniProt: Q14123
Position
7p14.3
AA seq 709 aa AA seqDB search
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDGTKQRSHGSPAPSTSSTCRLTLPVIKPPLR
HFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgccaaccaaggagattgaagaatttgagagcaactctctgaaatacctgcaa
ccggaacagatcgagaaaatctggcttcggctccgcgggctgaggaaatataagaaaacg
tcccagagattacggtctttggtcaaacaattagagagaggggaagcttcagtggtagat
cttaagaagaatttggaatatgcagccacagtgcttgaatctgtgtatattgatgaaaca
aggagactcctggatacagaggatgagctcagtgacattcagtcagatgctgtgccttct
gaggtccgagactggctggcctccaccttcacgcggcagatggggatgatgctcaggagg
agcgacgagaagccccggttcaagagcatcgttcacgcagtgcaggctgggatatttgtg
gagagaatgtatagacggacatcaaacatggttggactgagctatccaccagctgttatt
gaggcattaaaggatgtggacaagtggtcctttgacgtcttttccctcaatgaggccagt
ggggatcatgcactgaaatttattttctatgaactactcacacgttatgatctgatcagc
cgtttcaagatccccatttctgcacttgtctcatttgtggaggccctggaagtgggatac
agcaagcacaaaaatccttaccataacttaatgcacgctgccgatgttacacagacagtg
cattacctcctctataagacaggagtggcgaactggctgacggagctggagatctttgct
ataatcttctcagctgccatccatgactacgagcataccggaaccaccaacaatttccac
attcagactcggtctgatccagctattctgtataatgacagatctgtactggagaatcac
catttaagtgcagcttatcgccttctgcaagatgacgaggaaatgaatattttgattaac
ctctcaaaggatgactggagggagtttcgaaccttggtaattgaaatggtgatggccaca
gatatgtcttgtcacttccaacaaatcaaagcaatgaagactgctctgcagcagccagaa
gccattgaaaagccaaaagccttatcccttatgctgcatacagcagatattagccatcca
gcaaaagcatgggacctccatcatcgctggacaatgtcactcctggaggagttcttcaga
cagggtgacagagaagcagagctggggctgcctttttctcctctgtgtgaccgaaagtcc
actatggttgctcagtcacaagtaggtttcattgatttcatcgtggaacccaccttcact
gtgcttacggacatgaccgagaagattgtgagtccattaatcgatgaaacctctcaaact
ggtgggacaggacagaggcgttcgagtttgaatagcatcagctcgtcagatgccaagcga
tcaggtgtcaagacctctggttcagagggaagtgccccgatcaacaattctgtcatctcc
gttgactataagagctttaaagctacttggacggaagtggtgcacatcaatcgggagaga
tggagggccaaggtacccaaagaggagaaggccaagaaggaagcagaggaaaaggctcgc
ctggccgcagaggagcagcaaaaggaaatggaagccaaaagccaggctgaagaaggcgca
tctggcaaagctgagaaaaagacgtctggagaaactaagaatcaagtcaatggaacacgg
gcaaacaaaagtgacaaccctcgtgggaaaaactccaaagccgagaagtcatcaggagaa
cagcaacagaatggtgacttcaaagatggtaaaaataagacagacaagaaggatcactct
aacatcggaaatgattcaaagaaaacagatggcacaaaacagcgttctcacggctcacca
gccccaagcaccagctccacgtgtcgccttacgttgccagtcatcaagcctcctttgcgt
cattttaaacgccctgcttacgcatctagctcctatgcaccttcagtctcaaagaaaact
gatgagcatcctgcaaggtacaagatgctggatcagaggatcaaaatgaaaaagattcag
aacatctcacataactggaacagaaaatag

DBGET integrated database retrieval system