KEGG   Homo sapiens (human): 51373Help
Entry
51373             CDS       T01001                                 

Gene name
MRPS17, HSPC011, MRP-S17, RPMS17, S17mt
Definition
(RefSeq) mitochondrial ribosomal protein S17
  KO
K02961  small subunit ribosomal protein S17
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    51373 (MRPS17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    51373 (MRPS17)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    51373 (MRPS17)
  Bacteria
    51373 (MRPS17)
  Archaea
    51373 (MRPS17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S17
Motif
Other DBs
NCBI-GeneID: 51373
NCBI-ProteinID: NP_057053
OMIM: 611980
HGNC: 14047
Ensembl: ENSG00000239789
Vega: OTTHUMG00000023153
Pharos: Q9Y2R5(Tbio)
UniProt: Q9Y2R5
Position
7p11.2
AA seq 130 aa AA seqDB search
MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTV
GDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKN
LEELNISSAQ
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtagttcgctcatccgtccatgccagatggattgtggggaaggtgattgggaca
aaaatgcaaaagactgctaaagtgagagtgaccaggcttgttctggatccctatttatta
aagtattttaataagcggaaaacctactttgctcacgatgcccttcagcagtgcacagtt
ggggatattgtgcttctcagagctttacctgttccacgagcaaagcatgtgaaacatgaa
ctggctgagatcgttttcaaagttggaaaagtcatagatccagtgacaggaaagccctgt
gctggaactacctacctggagagtccgttgagttcggaaaccacccagctaagcaaaaat
ctggaagaactcaatatctcttcagcacagtga

DBGET integrated database retrieval system