KEGG   Homo sapiens (human): 5138Help
Entry
5138              CDS       T01001                                 

Gene name
PDE2A, CGS-PDE, PDE2A1, PED2A4, cGSPDE
Definition
(RefSeq) phosphodiesterase 2A
  KO
K18283  cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa04022  cGMP-PKG signaling pathway
hsa04740  Olfactory transduction
hsa04925  Aldosterone synthesis and secretion
hsa05032  Morphine addiction
Module
hsa_M00694  cGMP signaling
Drug target
Aminophylline (DG01062): D00227 D05429
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Diprophylline: D00691
Doxofylline: D03898
Flavoxate (DG00477): D00718 D07961
Moxaverine (DG00045): D07089 D08238
Papaverine (DG00043): D02218 D07425 D07439
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5138 (PDE2A)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    5138 (PDE2A)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    5138 (PDE2A)
  Sensory system
   04740 Olfactory transduction
    5138 (PDE2A)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    5138 (PDE2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5138 (PDE2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3
Motif
Other DBs
NCBI-GeneID: 5138
NCBI-ProteinID: NP_002590
OMIM: 602658
HGNC: 8777
Ensembl: ENSG00000186642
Vega: OTTHUMG00000102045
Pharos: O00408(Tclin)
UniProt: O00408 Q8IW54
Structure
PDB: 

Position
11q13.4
AA seq 941 aa AA seqDB search
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDI
SGLQRAVKEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCN
GLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAV
EKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDL
DASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV
EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTD
EDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggcatgcggccactccatcctctgcaggagccagcagtacccggcagcgcga
ccggctgagccgcggggccagcaggtcttcctcaagccggacgagccgccgccgccgccg
cagccatgcgccgacagcctgcaggacgccttgctgagtctgggctctgtcatcgacatt
tcaggcctgcaacgtgctgtcaaggaggccctgtcagctgtgctcccccgagtggaaact
gtctacacctacctactggatggtgagtcccagctggtgtgtgaggaccccccacatgag
ctgccccaggaggggaaagtccgggaggctatcatctcccagaagcggctgggctgcaat
gggctgggcttctcagacctgccagggaagcccttggccaggctggtggctccactggct
cctgatacccaagtgctggtcatgccgctagcggacaaggaggctggggccgtggcagct
gtcatcttggtgcactgtggccagctgagtgataatgaggaatggagcctgcaggcggtg
gagaagcataccctggtcgccctgcggagggtgcaggtcctgcagcagcgcgggcccagg
gaggctccccgagccgtccagaaccccccggaggggacggcggaagaccagaagggcggg
gcggcgtacaccgaccgcgaccgcaagatcctccaactgtgcggggaactctacgacctg
gatgcctcttccctgcagctcaaagtgctccaatacctgcagcaggagacccgggcatcc
cgctgctgcctcctgctggtgtcggaggacaatctccagctttcttgcaaggtcatcgga
gacaaagtgctcggggaagaggtcagctttcccttgacaggatgcctgggccaggtggtg
gaagacaagaagtccatccagctgaaggacctcacctccgaggatgtacaacagctgcag
agcatgttgggctgtgagctgcaggccatgctctgtgtccctgtcatcagccgggccact
gaccaggtggtggccttggcctgcgccttcaacaagctagaaggagacttgttcaccgac
gaggacgagcatgtgatccagcactgcttccactacaccagcaccgtgctcaccagcacc
ctggccttccagaaggaacagaaactcaagtgtgagtgccaggctcttctccaagtggca
aagaacctcttcacccacctggatgacgtctctgtcctgctccaggagatcatcacggag
gccagaaacctcagcaacgcagagatctgctctgtgttcctgctggatcagaatgagctg
gtggccaaggtgttcgacgggggcgtggtggatgatgagagctatgagatccgcatcccg
gccgatcagggcatcgcgggacacgtggcgaccacgggccagatcctgaacatccctgac
gcatatgcccatccgcttttctaccgcggcgtggacgacagcaccggcttccgcacgcgc
aacatcctctgcttccccatcaagaacgagaaccaggaggtcatcggtgtggccgagctg
gtgaacaagatcaatgggccatggttcagcaagttcgacgaggacctggcgacggccttc
tccatctactgcggcatcagcatcgcccattctctcctatacaaaaaagtgaatgaggct
cagtatcgcagccacctggccaatgagatgatgatgtaccacatgaaggtctccgatgat
gagtataccaaacttctccatgatgggatccagcctgtggctgccattgactccaatttt
gcaagtttcacctatacccctcgttccctgcccgaggatgacacgtccatggccatcctg
agcatgctgcaggacatgaatttcatcaacaactacaaaattgactgcccgaccctggcc
cggttctgtttgatggtgaagaagggctaccgggatcccccctaccacaactggatgcac
gccttttctgtctcccacttctgctacctgctctacaagaacctggagctcaccaactac
ctcgaggacatcgagatctttgccttgtttatttcctgcatgtgtcatgacctggaccac
agaggcacaaacaactctttccaggtggcctcgaaatctgtgctggctgcgctctacagc
tctgagggctccgtcatggagaggcaccactttgctcaggccatcgccatcctcaacacc
cacggctgcaacatctttgatcatttctcccggaaggactatcagcgcatgctggatctg
atgcgggacatcatcttggccacagacctggcccaccatctccgcatcttcaaggacctc
cagaagatggctgaggtgggctacgaccgaaacaacaagcagcaccacagacttctcctc
tgcctcctcatgacctcctgtgacctctctgaccagaccaagggctggaagactacgaga
aagatcgcggagctgatctacaaagaattcttctcccagggagacctggagaaggccatg
ggcaacaggccgatggagatgatggaccgggagaaggcctatatccctgagctgcaaatc
agcttcatggagcacattgcaatgcccatctacaagctgttgcaggacctgttccccaaa
gcggcagagctgtacgagcgcgtggcctccaaccgtgagcactggaccaaggtgtcccac
aagttcaccatccgcggcctcccaagtaacaactcgctggacttcctggatgaggagtac
gaggtgcctgatctggatggcactagggcccccatcaatggctgctgcagccttgatgct
gagtga

DBGET integrated database retrieval system