KEGG   Homo sapiens (human): 51382Help
Entry
51382             CDS       T01001                                 

Gene name
ATP6V1D, ATP6M, VATD, VMA8
Definition
(RefSeq) ATPase H+ transporting V1 subunit D
  KO
K02149  V-type H+-transporting ATPase subunit D
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04150  mTOR signaling pathway
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    51382 (ATP6V1D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    51382 (ATP6V1D)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    51382 (ATP6V1D)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    51382 (ATP6V1D)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    51382 (ATP6V1D)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    51382 (ATP6V1D)
  09171 Infectious diseases: Bacterial
   05110 Vibrio cholerae infection
    51382 (ATP6V1D)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    51382 (ATP6V1D)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    51382 (ATP6V1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_D
Motif
Other DBs
NCBI-GeneID: 51382
NCBI-ProteinID: NP_057078
OMIM: 609398
HGNC: 13527
Ensembl: ENSG00000100554
Vega: OTTHUMG00000171244
Pharos: Q9Y5K8(Tbio)
UniProt: Q9Y5K8 A0A024R683
Position
14q23.3
AA seq 247 aa AA seqDB search
MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGE
VMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYE
LTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRI
ERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEK
DEDLLFE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaaagaccgaattgaaatctttccctcgcgaatggcacagaccatcatgaag
gctcgtttaaagggagcacagacaggtcgaaacctcctgaagaaaaaatctgatgcctta
actcttcgatttcgacagatcctaaagaagataatagagactaaaatgttgatgggcgaa
gtgatgagagaagctgccttttcactagctgaagccaagttcacagcaggtgacttcagc
actacagttatccaaaatgtcaataaagcgcaagtgaagattcgagcgaagaaagataat
gtagcaggtgttactttgccagtatttgaacattaccatgaaggaactgacagttatgaa
ctgactggtttagccagaggtggggaacagttggctaaattaaagaggaattatgccaaa
gcagtggaactactggtggaactagcttctctgcagacttcttttgttactttggatgaa
gctattaagataaccaacaggcgtgtaaatgccattgaacatgtcatcattccccggatt
gaacgtactcttgcttatatcatcacagagctggatgagagagagcgagaagagttctat
aggttaaagaaaatacaagagaagaaaaagattctaaaggaaaaatctgagaaggacttg
gagcaaaggagagcagctggagaggtgttggagcctgctaatcttctggctgaagagaag
gacgaggatcttctatttgaataa

DBGET integrated database retrieval system