KEGG   Homo sapiens (human): 51386
Entry
51386             CDS       T01001                                 

Gene name
EIF3L, EIF3EIP, EIF3S11, EIF3S6IP, HSPC021, HSPC025, MSTP005
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit L
  KO
K15029  translation initiation factor 3 subunit L
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    51386 (EIF3L)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    51386 (EIF3L)
SSDB
Motif
Pfam: Paf67 TPR_2 TPR_1 ANAPC3
Other DBs
NCBI-GeneID: 51386
NCBI-ProteinID: NP_057175
HGNC: 18138
Ensembl: ENSG00000100129
Vega: OTTHUMG00000150671
Pharos: Q9Y262(Tdark)
UniProt: Q9Y262
Structure
PDB: 
3J8B 3J8C

Position
22q13.1
AA seq 564 aa
MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFH
KTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAP
QVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPN
QWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNI
NRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELN
KKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMI
NKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKF
LSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLD
LTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYG
DFFIRQIHKFEELNRTLKKMGQRP
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgtcttatcccgctgatgattatgagtctgaggcggcttatgacccctacgcttatccc
agcgactatgatatgcacacaggagatccaaagcaggaccttgcttatgaacgtcagtat
gaacagcaaacctatcaggtgatccctgaggtgatcaaaaacttcatccagtatttccac
aaaactgtctcagatttgattgaccagaaagtgtatgagctacaggccagtcgtgtctcc
agtgatgtcattgaccagaaggtgtatgagatccaggacatctatgagaacagctggacc
aagctgactgaaagattcttcaagaatacaccttggcccgaggctgaagccattgctcca
caggttggcaatgatgctgtcttcctgattttatacaaagaattatactacaggcacata
tatgccaaagtcagtgggggaccttccttggagcagaggtttgaatcctattacaactac
tgcaatctcttcaactacattcttaatgccgatggtcctgctccccttgaactacccaac
cagtggctctgggatattatcgatgagttcatctaccagtttcagtcattcagtcagtac
cgctgtaagactgccaagaagtcagaggaggagattgactttcttcgttccaatcccaaa
atctggaatgttcatagtgtcctcaatgtccttcattccctggtagacaaatccaacatc
aaccgacagttggaggtatacacaagcggaggtgaccctgagagtgtggctggggagtat
gggcggcactccctctacaaaatgcttggttacttcagcctggtcgggcttctccgcctg
cactccctgttaggagattactaccaggccatcaaggtgctggagaacatcgaactgaac
aagaagagtatgtattcccgtgtgccagagtgccaggtcaccacatactattatgttggg
tttgcatatttgatgatgcgtcgttaccaggatgccatccgggtcttcgccaacatcctc
ctctacatccagaggaccaagagcatgttccagaggaccacgtacaagtatgagatgatt
aacaagcagaatgagcagatgcatgcgctgctggccattgccctcacgatgtaccccatg
cgtattgatgagagcattcacctccagctgcgggagaaatatggggacaagatgttgcgc
atgcagaaaggtgacccacaagtctatgaagaacttttcagttactcctgccccaagttc
ctgtcgcctgtagtgcccaactatgataatgtgcaccccaactaccacaaagagcccttc
ctgcagcagctgaaggtgttttctgatgaagtacagcagcaggcccagctttcaaccatc
cgcagcttcctgaagctctacaccaccatgcctgtggccaagctggctggcttcctggac
ctcacagagcaggagttccggatccagcttcttgtcttcaaacacaagatgaagaacctc
gtgtggaccagcggtatctcagccctggatggtgaatttcagtcagcctcagaggttgac
ttctacattgataaggacatgatccacatcgcggacaccaaggtcgccaggcgttatggg
gatttcttcatccgtcagatccacaaatttgaggagcttaatcgaaccctgaagaagatg
ggacagagaccttga

DBGET integrated database retrieval system