KEGG   Homo sapiens (human): 51388Help
Entry
51388             CDS       T01001                                 

Gene name
NIP7, CGI-37, HSPC031, KD93
Definition
(RefSeq) nucleolar pre-rRNA processing protein NIP7
  KO
K07565  60S ribosome subunit biogenesis protein NIP7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    51388 (NIP7)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    51388 (NIP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0113_N UPF0113 PUA PP1 PEPCK_GTP
Motif
Other DBs
NCBI-GeneID: 51388
NCBI-ProteinID: NP_057185
HGNC: 24328
Ensembl: ENSG00000132603
Vega: OTTHUMG00000137568
Pharos: Q9Y221(Tbio)
UniProt: Q9Y221
Structure
PDB: 

Position
16q22.1
AA seq 180 aa AA seqDB search
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISG
DKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcggcctttgactgaagaggagacccgtgtcatgtttgagaagatagcgaaatacatt
ggggagaatcttcaactgctggtggaccggcccgatggcacctactgtttccgtctgcac
aacgaccgggtgtactatgtgagtgagaagattatgaagctggccgccaatatttccggg
gacaagctggtgtcgctggggacctgctttggaaaattcactaaaacccacaagtttcgg
ttgcacgtcacagctctggattaccttgcaccttatgccaagtataaagtttggataaag
cctggtgcagagcagtccttcctgtatgggaaccatgtgttgaaatctggtctgggtcga
atcactgaaaatacttctcagtaccagggcgtggtggtgtactccatggcagacatccct
ttgggttttggggtggcagccaaatctacacaagactgcagaaaagtagaccccatggcg
attgtggtatttcatcaagcagacattggggaatatgtgcggcatgaagagacgttgact
taa

DBGET integrated database retrieval system