KEGG   Homo sapiens (human): 51389
Entry
51389             CDS       T01001                                 

Gene name
RWDD1, CGI-24, PTD013
Definition
(RefSeq) RWD domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: RWD DFRP_C ACC_central Folliculin PARP BUD22
Other DBs
NCBI-GeneID: 51389
NCBI-ProteinID: NP_057036
HGNC: 20993
Ensembl: ENSG00000111832
Vega: OTTHUMG00000015441
Pharos: Q9H446(Tdark)
UniProt: Q9H446
Structure
PDB: 
2EBM

Position
6q22.1
AA seq 243 aa
MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKY
PDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKT
RREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNK
LSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYNPADPESD
SAD
NT seq 732 nt   +upstreamnt  +downstreamnt
atgacagattacggcgaggagcagcgcaacgagctggaggccctggagtccatctaccct
gactccttcacagtattatcagaaaatccacccagcttcaccattactgtgacgtctgag
gctggagaaaatgatgaaactgtccagactaccctcaagtttacatacagtgaaaaatac
ccagatgaagctcccctttatgaaatattctcccaggaaaatctagaagataatgatgtc
tcagacattttaaaattactagcattacaggctgaagaaaatcttggtatggtgatgatt
tttactctagtgacagctgtgcaagaaaaattaaatgaaatagtagatcagataaaaact
agaagagaagaagaaaagaaacaaaaagaaaaagaagcagaagaagctgaaaagcaatta
ttccatggtactccagttacaattgagaatttcttaaattggaaagccaagtttgatgca
gaactcttggaaattaaaaagaaaaggatgaaagaagaagaacaagcaggaaaaaataaa
ttaagtgggaaacaactatttgaaacagatcataatcttgacacatctgatatccagttc
ttggaggatgctggaaacaacgtggaggtagatgagtctttgttccaagaaatggatgac
ttggagctggaggatgatgaagatgatccagactataatcctgctgacccagagagtgac
tcagctgactaa

DBGET integrated database retrieval system