KEGG   Homo sapiens (human): 5139Help
Entry
5139              CDS       T01001                                 

Gene name
PDE3A, CGI-PDE, CGI-PDE_A, CGI-PDE-A, HTNB
Definition
(RefSeq) phosphodiesterase 3A
  KO
K19021  cGMP-inhibited 3',5'-cyclic phosphodiesterase A [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04924  Renin secretion
hsa05032  Morphine addiction
Disease
H00482  Brachydactyly
Drug target
Aminophylline (DG01062): D00227 D05429
Amrinone (DG00228): D00231 D02084
Anagrelide (DG00727): D02933 D07455 D10255
Bemoradan: D03075
Beradilol monoethyl maleate: D09843
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Cilostazol: D01896
Diprophylline: D00691
Enoximone: D04004
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Ibudilast: D01385
Imazodan hydrochloride: D04508
Indolidan: D04529
Isomazole hydrochloride: D04628
Levosimendan: D04720
Lixazinone sulfate: D04751
Milrinone (DG00229): D00417 D02085
Moxaverine (DG00045): D07089 D08238
Olprinone (DG01396): D02042 D08294
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Pimobendan: D01133
Piroximone: D05514
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Toborinone: D01198
Trapidil: D01220
Vesnarinone: D01690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5139 (PDE3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5139 (PDE3A)
   04022 cGMP-PKG signaling pathway
    5139 (PDE3A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5139 (PDE3A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5139 (PDE3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5139 (PDE3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I
Motif
Other DBs
NCBI-GeneID: 5139
NCBI-ProteinID: NP_000912
OMIM: 123805
HGNC: 8778
Ensembl: ENSG00000172572
Vega: OTTHUMG00000168962
Pharos: Q14432(Tclin)
UniProt: Q14432
Position
12p12.2
AA seq 1141 aa AA seqDB search
MAVPGDAARVRDKPVHSGVSQAPTAGRDCHHRADPASPRDSGCRGCWGDLVLQPLRSSRK
LSSALCAGSLSFLLALLVRLVRGEVGCDLEQCKEAAAAEEEEAAPGAEGGVFPGPRGGAP
GGGARLSPWLQPSALLFSLLCAFFWMGLYLLRAGVRLPLAVALLAACCGGEALVQIGLGV
GEDHLLSLPAAGVVLSCLAAATWLVLRLRLGVLMIALTSAVRTVSLISLERFKVAWRPYL
AYLAGVLGILLARYVEQILPQSAEAAPREHLGSQLIAGTKEDIPVFKRRRRSSSVVSAEM
SGCSSKSHRRTSLPCIPREQLMGHSEWDHKRGPRGSQSSGTSITVDIAVMGEAHGLITDL
LADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSDSEESSEKDKLA
IPKRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSSSPDSWN
NPVMMTLTKSRSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPASSLVS
KISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADE
PLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRKASACSTYA
PETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFE
DMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTVIN
DHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDH
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFL
VIEAILATDLKKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKEL
HLQWTDGIVNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAG
LMPGKWVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPKKKTFKRRKIYCQITQHLL
QNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTQKPD
Q
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgcccggcgacgctgcacgagtcagggacaagcccgtccacagtggggtgagt
caagcccccacggcgggccgggactgccaccatcgtgcggaccccgcatcgccgcgggac
tcgggctgccgtggctgctggggagacctggtgctgcagccgctccggagctctcggaaa
ctttcctccgcgctgtgcgcgggctccctgtcctttctgctggcgctgctggtgaggctg
gtccgcggggaggtcggctgtgacctggagcagtgtaaggaggcggcggcggcggaggag
gaggaagcagccccgggagcagaagggggcgtcttcccggggcctcggggaggtgctccc
gggggcggtgcgcggctcagcccctggctgcagccctcggcgctgctcttcagtctcctg
tgtgccttcttctggatgggcttgtacctcctgcgcgccggggtgcgcctgcctctggct
gtcgcgctgctggccgcctgctgcgggggggaagcgctcgtccagattgggctgggcgtc
ggggaggatcacttactctcactccccgccgcgggggtggtgctcagctgcttggccgcc
gcgacatggctggtgctgaggctgaggctgggcgtcctcatgatcgccttgactagcgcg
gtcaggaccgtgtccctcatttccttagagaggttcaaggtcgcctggagaccttacctg
gcgtacctggccggcgtgctggggatcctcttggccaggtacgtggaacaaatcttgccg
cagtccgcggaggcggctccaagggagcatttggggtcccagctgattgctgggaccaag
gaagatatcccggtgtttaagaggaggaggcggtccagctccgtcgtgtccgccgagatg
tccggctgcagcagcaagtcccatcggaggacctccctgccctgtataccgagggaacag
ctcatggggcattcagaatgggaccacaaacgagggccaagaggatcacagtcttcagga
accagtattactgtggacatcgccgtcatgggcgaggcccacggcctcattaccgacctc
ctggcagacccttctcttccaccaaacgtgtgcacatccttgagagccgtgagcaacttg
ctcagcacacagctcaccttccaggccattcacaagcccagagtgaatcccgtcacttcg
ctcagtgaaaactatacctgttctgactctgaagagagctctgaaaaagacaagcttgct
attccaaagcgcctgagaaggagtttgcctcctggcttgttgagacgagtttcttccact
tggaccaccaccacctcggccacaggtctacccaccttggagcctgcaccagtacggaga
gaccgcagcaccagcatcaaactgcaggaagcaccttcatccagtcctgattcttggaat
aatccagtgatgatgaccctcaccaaaagcagatcctttacttcatcctatgctatttct
gcagctaaccatgtaaaggctaaaaagcaaagtcgaccaggtgccctcgctaaaatttca
cctctttcatcgccctgctcctcacctctccaagggactcctgccagcagcctggtcagc
aaaatttctgcagtgcagtttccagaatctgctgacacaactgccaaacaaagcctaggt
tctcacagggccttaacttacactcagagtgccccagacctatcccctcaaatcctgact
ccacctgttatatgtagcagctgtggcagaccatattcccaagggaatcctgctgatgag
cccctggagagaagtggggtagccactcggacaccaagtagaacagatgacactgctcaa
gttacctctgattatgaaaccaataacaacagtgacagcagtgacattgtacagaatgaa
gatgaaacagagtgcctgagagagcctctgaggaaagcatcggcttgcagcacctatgct
cctgagaccatgatgtttctggacaaaccaattcttgctcccgaacctcttgtcatggat
aacctggactcaattatggagcagctaaatacttggaattttccaatttttgatttagtg
gaaaatataggaagaaaatgtggccgtattcttagtcaggtatcttacagactttttgaa
gacatgggcctctttgaagcttttaaaattccaattagggaatttatgaattattttcat
gctttggagattggatatagggatattccttatcataacagaatccatgccactgatgtt
ttacatgctgtttggtatcttactacacagcctattccaggcctctcaactgtgattaat
gatcatggttcaaccagtgattcagattctgacagtggatttacacatggacatatggga
tatgtattctcaaaaacgtataatgtgacagatgataaatacggatgtctgtctgggaat
atccctgccttggagttgatggcgctgtatgtggctgcagccatgcacgattatgatcat
ccaggaaggactaatgctttcctggttgcaactagtgctcctcaggcggtgctatataac
gatcgttcagttttggagaatcatcacgcagctgctgcatggaatcttttcatgtcccgg
ccagagtataacttcttaattaaccttgaccatgtggaatttaagcatttccgtttcctt
gtcattgaagcaattttggccactgacctgaagaaacactttgacttcgtagccaaattt
aatggcaaggtaaatgatgatgttggaatagattggaccaatgaaaatgatcgtctactg
gtttgtcaaatgtgtataaagttggctgatatcaatggtccagctaaatgtaaagaactc
catcttcagtggacagatggtattgtcaatgaattttatgaacagggtgatgaagaggcc
agccttggattacccataagccccttcatggatcgttctgctcctcagctggccaacctt
caggaatccttcatctctcacattgtggggcctctgtgcaactcctatgattcagcagga
ctaatgcctggaaaatgggtggaagacagcgatgagtcaggagatactgatgacccagaa
gaagaggaggaagaagcaccagcaccaaatgaagaggaaacctgtgaaaataatgaatct
ccaaaaaagaagactttcaaaaggagaaaaatctactgccaaataactcagcacctctta
cagaaccacaagatgtggaagaaagtcattgaagaggagcaacggttggcaggcatagaa
aatcaatccctggaccagacccctcagtcgcactcttcagaacagatccaggctatcaag
gaagaagaagaagagaaagggaaaccaagaggcgaggagataccaacccaaaagccagac
cagtga

DBGET integrated database retrieval system