KEGG   Homo sapiens (human): 51397
Entry
51397             CDS       T01001                                 
Symbol
COMMD10, PTD002
Name
(RefSeq) COMM domain containing 10
  KO
K22566  COMM domain containing 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51397 (COMMD10)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    51397 (COMMD10)
SSDB
Motif
Pfam: COMM_domain DivIC 7TMR-HDED
Other DBs
NCBI-GeneID: 51397
NCBI-ProteinID: NP_057228
OMIM: 616704
HGNC: 30201
Ensembl: ENSG00000145781
Pharos: Q9Y6G5(Tdark)
UniProt: Q9Y6G5
Position
5:116085025..116293287
AA seq 202 aa
MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAA
FSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQET
VEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFS
HKELFDFYNKLETIQAQLDSLT
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcggtccccgcggcgctgatcctacgggagagccccagcatgaagaaagcagtgtca
ctgataaatgcaatagatacaggaagatttccacggttgctcactcggattcttcaaaaa
cttcacctgaaggctgagagcagtttcagtgaagaagaggaagaaaaacttcaagcggca
ttttctctagagaaacaagatcttcacctagttcttgaaacaatatcatttattttagaa
caggcagtgtatcacaatgtgaagccagcagctttgcagcagcaattagagaacattcat
cttagacaagacaaagctgaagcatttgtcaatacgtggtcttctatgggtcaagaaaca
gttgaaaagttccggcagagaattctggctccctgtaagctagagaccgttggatggcag
cttaaccttcagatggctcactctgctcaagcaaaactaaaatctcctcaagctgtgtta
caactcggagtgaacaatgaagattcaaagagcctggagaaagttcttgtggaattcagt
cacaaggagttgtttgatttctataacaagctagagactatacaagcacagctggattcc
cttacatga

DBGET integrated database retrieval system