KEGG   Homo sapiens (human): 51399
Entry
51399             CDS       T01001                                 

Gene name
TRAPPC4, CGI-104, HSPC172, NEDESBA, PTD009, SBDN, SYNBINDIN, TRS23
Definition
(RefSeq) trafficking protein particle complex 4
  KO
K20303  trafficking protein particle complex subunit 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51399 (TRAPPC4)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    51399 (TRAPPC4)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    51399 (TRAPPC4)
SSDB
Motif
Pfam: Sybindin Sedlin_N PDZ_6 PDZ
Other DBs
NCBI-GeneID: 51399
NCBI-ProteinID: NP_057230
OMIM: 610971
HGNC: 19943
Ensembl: ENSG00000196655
Vega: OTTHUMG00000166351
Pharos: Q9Y296(Tbio)
UniProt: Q9Y296
Structure
PDB: 
2ZMV 2JSN 2J3T

Position
11q23.3
AA seq 219 aa
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVG
HAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFA
IGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDF
ALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcgatttttagtgtgtatgtggtgaacaaagctggcggcttgatttaccagttggac
agctacgcgccacgggctgaggctgagaaaactttcagttatccgctggatctgctgctc
aagctacacgatgagcgtgtgttggttgctttcggccagcgggacggcatccgagtgggt
catgcagtgctggccatcaatggcatggacgtgaatggcaggtacacggccgacgggaaa
gaggtgctggagtatctgggtaaccctgctaattacccggtgtccattcgatttggccgg
ccccgcctcacttctaatgagaagcttatgctggcctccatgttccactcgctctttgcc
atcggctcccagctgtctcctgaacagggaagctcaggcattgagatgctggagacagac
acattcaaattgcactgctaccagacactgacagggatcaagtttgtggttctagcagat
cctaggcaagctggaatagattctcttctccgaaagatttatgagatttactcagacttt
gccctcaagaatccattctattccttagaaatgcctatcaggtgtgagctctttgaccag
aacctgaagctagctctggaggtggcagagaaggctggaacttttggacctgggtcatag

DBGET integrated database retrieval system