KEGG   Homo sapiens (human): 514Help
Entry
514               CDS       T01001                                 

Gene name
ATP5F1E, ATP5E, ATPE, MC5DN3
Definition
(RefSeq) ATP synthase F1 subunit epsilon
  KO
K02135  F-type H+-transporting ATPase subunit epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00158  F-type ATPase, eukaryotes
Disease
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    514 (ATP5F1E)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    514 (ATP5F1E)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    514 (ATP5F1E)
   05012 Parkinson disease
    514 (ATP5F1E)
   05016 Huntington disease
    514 (ATP5F1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_Eps
Motif
Other DBs
NCBI-GeneID: 514
NCBI-ProteinID: NP_008817
OMIM: 606153
HGNC: 838
Ensembl: ENSG00000124172
Vega: OTTHUMG00000032854
Pharos: P56381(Tbio)
UniProt: P56381
Position
20q13.32
AA seq 51 aa AA seqDB search
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctactggagacaggctggactcagctacatccgatactcccagatctgtgca
aaagcagtgagagatgcactgaagacagaattcaaagcaaatgctgagaagacttctggc
agcaacgtaaaaattgtgaaagtaaagaaggaataa

DBGET integrated database retrieval system