KEGG   Homo sapiens (human): 51409
Entry
51409             CDS       T01001                                 
Symbol
HEMK1, HEMK, MPRMC, MTQ1
Name
(RefSeq) HemK methyltransferase family member 1
  KO
K02493  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    51409 (HEMK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     51409 (HEMK1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Release factors
   51409 (HEMK1)
 Prokaryotic type
   51409 (HEMK1)
SSDB
Motif
Pfam: PrmC_N MTS Methyltransf_25 Methyltransf_31 Cons_hypoth95 PrmA Methyltransf_12 Methyltransf_11 Methyltransf_15 UPF0020 Methyltransf_4 Methyltransf_16 Methyltransf_32 Methyltransf_23 PRMT5 Methyltransf_24 N6_N4_Mtase Methyltransf_18 Methyltr_RsmB-F
Other DBs
NCBI-GeneID: 51409
NCBI-ProteinID: NP_001304780
OMIM: 618609
HGNC: 24923
Ensembl: ENSG00000114735
Pharos: Q9Y5R4(Tbio)
UniProt: Q9Y5R4 A0A140VK98
Position
3:50569180..50596166
AA seq 338 aa
MELWGRMLWALLSGPGRRGSTRGWAFSSWQPQPPLAGLSSAIELVSHWTGVFEKRGIPEA
RESSEYIVAHVLGAKTFQSLRPALWTQPLTSQQLQCIRELSSRRLQRMPVQYILGEWDFQ
GLSLRMVPPVFIPRPETEELVEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQ
LPQSRVIAVDKREAAISLTHENAQRLRLQDRIWIIHLDMTSERSWTHLPWGPMDLIVSNP
PYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILALAPRLLKDSGSIFLEVDPRHP
ELVSSWLQSRPDLYLNLVAVRRDFCGRPRFLHIRRSGP
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggagctttggggccgaatgctgtgggccctcctgtctggcccagggaggaggggaagt
acccggggctgggccttcagctcatggcaaccccaaccacctctggctgggttatccagt
gccatagaactggtcagccactggactggggtctttgagaagaggggtatccctgaggcc
cgggaatccagtgagtacatcgtggctcatgtccttggagccaaaacatttcagagcctg
aggccggcactttggacccagcccttgacctctcagcaactacagtgtatccgggagctg
agtagccgtcgattgcagaggatgccggtgcagtacatccttggagagtgggacttccag
gggctcagcctaaggatggtgcccccagtgtttattcctcggccagaaacagaggaactg
gttgagtgggtgctggaagaggtggcccagaggtcccatgctgtgggatccccaggcagc
cccctcattctggaggtgggctgcggatcaggagccatctccctcagcctgctgagccag
ctcccccagagccgagtcattgctgtggataagcgggaagctgctatctctctgacccat
gagaatgctcagaggcttcggttgcaggacaggatttggatcatccacctcgacatgacc
tcagaaaggagctggacacacctgccctggggccccatggacctgattgtcagcaaccct
ccctacgtcttccaccaggacatggagcagctggcccctgagatccgcagctatgaagac
cccgcggccctggatggtggggaggagggcatggacatcattacccacattctggccttg
gcaccccggctcctgaaagactctggtagtatcttcttagaagtggacccaaggcacccg
gagcttgtcagcagctggcttcagagccggcctgacctgtaccttaatcttgtggctgtg
cgcagggacttctgtgggaggccccggttcctgcatatccggaggtctgggccatag

DBGET integrated database retrieval system