KEGG   Homo sapiens (human): 51411
Entry
51411             CDS       T01001                                 

Gene name
BIN2, BRAP-1
Definition
(RefSeq) bridging integrator 2
  KO
K20119  bridging integrator 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51411 (BIN2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    51411 (BIN2)
SSDB
Motif
Pfam: BAR SseC
Other DBs
NCBI-GeneID: 51411
NCBI-ProteinID: NP_057377
OMIM: 605936
HGNC: 1053
Ensembl: ENSG00000110934
Vega: OTTHUMG00000185197
Pharos: Q9UBW5(Tbio)
UniProt: Q9UBW5
Structure
PDB: 
4AVM 4I1Q

Position
12q13.13
AA seq 565 aa
MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKL
YKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQ
AVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKA
QTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEK
QHSNKVFVVKGLSSSSRRSLVISPPVRTATVSSPLTSPTSPSTLSLKSESESVSATEDLA
PDAAQGEDNSEIKELLEEEEIEKEGSEASSSEEDEPLPACNGPAQAQPSPTTERAKSQEE
VLPSSTTPSPGGALSPSGQPSSSATEVVLRTRTASEGSEQPKKRASIQRTSAPPSRPPPP
RATASPRPSSGNIPSSPTASGGGSPTSPRASLGTGTASPRTSLEVSPNPEPPEKPVRTPE
AKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISANSSEGQDQLQVS
MVPENNNLTAPEPQEEVSTSENPQL
NT seq 1698 nt   +upstreamnt  +downstreamnt
atggcagagggcaaggcaggcggcgcggccggcctcttcgccaagcaggtgcagaagaag
tttagcagggcccaggagaaggtgctgcagaaattggggaaagctgtagaaaccaaagat
gaacgatttgaacaaagcgctagcaacttctaccaacaacaggcagaaggccacaagctg
tacaaggacctgaagaacttccttagtgcagtcaaagtgatgcatgaaagttcaaaaaga
gtgtcagaaaccctgcaggagatctacagcagcgagtgggacggtcatgaggagctgaag
gccatcgtatggaataatgatctcctttgggaagactacgaggagaaactggctgaccag
gctgtaaggaccatggaaatctatgttgcccagttcagtgaaattaaggagagaattgcc
aagcggggtcggaaactcgtggactatgacagtgcccgacaccacctggaggcagtgcag
aatgccaagaagaaagatgaggccaagactgccaaggcagaggaagagttcaacaaagcc
cagactgtgtttgaagatctgaaccaagaactactagaggagctgcctattctttataat
agtcgtattggctgctatgtgaccatcttccaaaacatttccaacttgagggatgtcttc
tacagggaaatgagcaagctgaaccacaatctctacgaggtgatgagcaaactggagaag
caacattccaataaagtctttgtggtgaagggactgtcaagcagcagcaggcgctcttta
gtcatttctcccccagttcgaacagctacagtctccagtcctcttacctcacctactagt
ccctctacactttccttgaagagtgagagtgaatctgtctcagcaactgaagatctggca
cctgatgcagcccaaggggaagacaattctgagatcaaggagctcttagaagaggaggaa
atagagaaggaaggatctgaagcaagctcctctgaggaagatgagcctctaccagcctgc
aatggccccgcccaggcccagccctctcctaccactgaaagggccaagtcccaggaggaa
gttctccccagctccacaactccatcaccaggcggagccctgagcccttcagggcagcct
tcatcatctgccacagaagtagtcctccgaacccgcaccgcaagtgaaggatctgaacaa
ccaaagaagagagcctctatccagaggacctcagcaccccctagtaggcctcctccaccc
agagccactgcaagccccaggccctcctcagggaacataccttccagccctacagcctct
ggagggggttcacccaccagccctagggcctccttggggactgggactgcaagtcctagg
acctccctagaggtctctcctaatccagaaccaccagagaagccagtaagaactcctgag
gccaaagaaaatgaaaacatccacaatcagaaccctgaagaactttgtacttcccccacc
ttaatgacatctcaggttgcttcagagcctggagaggcaaagaagatggaagacaaggaa
aaggataataagcttatctcagctaactcctcggagggccaagaccagcttcaagtctcc
atggtaccagaaaacaacaacctcacagcacctgaacctcaagaagaggtatccacaagt
gaaaatccacaactctga

DBGET integrated database retrieval system