KEGG   Homo sapiens (human): 51421
Entry
51421             CDS       T01001                                 

Gene name
AMOTL2, LCCP
Definition
(RefSeq) angiomotin like 2
  KO
K06104  angiomotin like
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51421 (AMOTL2)
SSDB
Motif
Pfam: Angiomotin_C
Other DBs
NCBI-GeneID: 51421
NCBI-ProteinID: NP_057285
OMIM: 614658
HGNC: 17812
Ensembl: ENSG00000114019
Vega: OTTHUMG00000159777
Pharos: Q9Y2J4(Tbio)
UniProt: Q9Y2J4
Position
3q22.2
AA seq 780 aa
MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGTGGTGSPQASLEILAP
EDSQVLQQATRQEPQGQEHQGGENHLAENTLYRLCPQPSKGEELPTYEEAKAHSQYYAAQ
QAGTRPHAGDRDPRGAPGGSRRQDEALRELRHGHVRSLSERLLQLSLERNGARAPSHMSS
SHSFPQLARNQQGPPLRGPPAEGPESRGPPPQYPHVVLAHETTTAVTDPRYRARGSPHFQ
HAEVRILQAQVPPVFLQQQQQYQYLQQSQEHPPPPHPAALGHGPLSSLSPPAVEGPVSAQ
ASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHE
SLTRASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQAGSQDMV
AKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRRAELLEQALGNAQGRAARAEEELRKKQ
AYVEKVERLQQALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQAGAPGGSSGSGGS
PELSALRLSEQLREKEEQILALEADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIR
HSPQPSPSSSFNEGLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRRDPGKAIQG
SLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTADRAPTEEPVVTAPPAAHA
KHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgaggacactggaagactcctcggggacagtcctgcaccgcctcatccaggagcagctg
cgctacggcaacctgactgagacgcgcacgctgctagccatccagcagcaggccctgagg
ggtggggctggaactgggggtacagggagcccccaggcctccctggagatcctggcccca
gaggacagtcaggtgctgcagcaggccaccaggcaggagccccagggccaggagcaccag
ggcggtgagaaccacctggcagagaacaccctctaccggctatgcccacagcccagcaag
ggagaggagctgcccacctatgaggaggccaaagcccactcgcagtactatgcggcccag
caggcagggacccggccacatgcgggggaccgagatccccgtggggccccgggaggcagt
cggaggcaggacgaggccctgcgggagctgaggcatgggcacgtgcgctcgttgagtgaa
cggctccttcagttgtccctggagaggaacggcgcccgggcccccagccacatgagctcc
tcccacagcttcccacagctggcccgcaaccagcagggccccccactgaggggcccccct
gctgagggcccagagtcccgaggacccccacctcagtaccctcatgttgtactagctcat
gagaccaccactgctgtcactgacccacggtaccgtgcccgcggcagcccgcacttccag
catgctgaagtcaggatcctgcaggcccaggtgcctcctgtgttcctccaacagcagcag
cagtaccagtacctgcagcaatctcaggagcacccccctcccccacatccagctgctctc
ggccatggccccctgagctccctcagtccacctgctgtggaggggccagtgagtgcccag
gcctcctcagccacctcgggcagtgcccacctggcccagatggaggccgtgctgagggag
aatgccaggctgcagagagacaatgagcggctgcagagggagctggagagctctgcggag
aaggctggccgcattgagaagctggaaagcgaaatccagcggctctctgaggcccatgag
agcctgaccagagcctcctccaagcgtgaggccctggagaagaccatgcggaacaagatg
gacagtgaaatgaggaggctgcaagacttcaaccgggatcttagagagagattggaatct
gcaaatcgccgcctggcaagcaagacacaggaggcccaggccggcagtcaggacatggtg
gccaagctgcttgctcagagctacgaacagcagcaggagcaagagaagctggagcgagag
atggcactgctgcgcggcgccatcgaggaccagcggcggcgtgccgagctgctggagcag
gctctgggcaatgcgcagggccgggcagctcgagccgaagaggagctgcgcaagaagcag
gcctatgtggagaaagtggagcggctgcagcaggcgctcgggcagctgcaggcagcctgt
gagaagcgggagcagctggagctgcgtctgcggactcgcctggagcaggaactcaaggcc
ctgcgtgcacagcagagacaggcaggtgccccaggtggtagcagtggcagtggtgggtct
ccagagctcagcgccctgcgactgtcagaacaactgcgagagaaggaggagcagatcctg
gcgctggaggccgacatgaccaagtgggagcagaagtatttggaggaacgtgccatgagg
cagtttgccatggatgcggctgccacggctgctgctcagcgtgacaccactctcatccga
cattccccccagccctcacccagcagcagcttcaatgagggtctgctcactggtggccac
aggcatcaggagatggaaagcaggttaaaggtgctccatgcccagatcctggagaaggat
gcagtgatcaaggtccttcagcagcgctccaggagagaccctggcaaggccatccagggc
tccctgcggcctgccaagtcggtgccatctgttttcgcggctgcggcagcaggaacccag
ggctggcaagggctctcttctagtgagcgacaaacagcagacgcccctgctcggctgact
acagcagacagagcacccacagaggagccagtggtcacagctccccctgctgcccatgcc
aaacacgggagcagagatgggagcacccagactgagggccccccagacagcacctccacc
tgcctgccaccggagcctgacagccttctggggtgcagcagtagccagagagcagcctct
ctggactctgtagctacatccagagtccaggacttgtcagacatggtggagatactgatc
tga

DBGET integrated database retrieval system