KEGG   Homo sapiens (human): 51422Help
Entry
51422             CDS       T01001                                 

Gene name
PRKAG2, AAKG, AAKG2, CMH6, H91620p, WPWS
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Disease
H00069  Glycogen storage disease
H00292  Hypertrophic cardiomyopathy
H01154  Wolff-Parkinson-White (WPW) syndrome
H01956  Glycogen storage disease of heart
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    51422 (PRKAG2)
   04068 FoxO signaling pathway
    51422 (PRKAG2)
   04152 AMPK signaling pathway
    51422 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51422 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    51422 (PRKAG2)
   04922 Glucagon signaling pathway
    51422 (PRKAG2)
   04920 Adipocytokine signaling pathway
    51422 (PRKAG2)
   04921 Oxytocin signaling pathway
    51422 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    51422 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    51422 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    51422 (PRKAG2)
   04714 Thermogenesis
    51422 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    51422 (PRKAG2)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51422 (PRKAG2)
   04931 Insulin resistance
    51422 (PRKAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3
Motif
Other DBs
NCBI-GeneID: 51422
NCBI-ProteinID: NP_057287
OMIM: 602743
HGNC: 9386
Ensembl: ENSG00000106617
Vega: OTTHUMG00000157324
Pharos: Q9UGJ0(Tbio)
UniProt: Q9UGJ0 A0A090N8Q6
Position
7q36.1
AA seq 569 aa AA seqDB search
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS
RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA
GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG
VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP
LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF
MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN
LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS
IVGIISLSDILQALILTPAGAKQKETETE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgcggttatggacaccaagaagaaaaaagatgtttccagccccggcgggagc
ggcggcaagaaaaatgccagccagaagaggcgttcgctgcgcgtgcacattccggacctg
agctccttcgccatgccgctcctggacggagacctggagggttccggaaagcattcctct
cgaaaggtggacagccccttcggcccgggcagcccctccaaagggttcttctccagaggc
ccccagccccggccctccagccccatgtctgcacctgtgaggcccaagaccagccccggc
tctcccaaaaccgtgttcccgttctcctaccaggagtccccgccacgctcccctcgacgc
atgagcttcagtgggatcttccgctcctcctccaaagagtcttcccccaactccaaccct
gctacctcgcccgggggcatcaggtttttctcccgctccagaaaaacctccggcctctcc
tcctctccgtcaacacccacccaagtgaccaagcagcacacgtttcccctggaatcctat
aagcacgagcctgaacggttagagaatcgcatctatgcctcgtcttcccccccggacaca
gggcagaggttctgcccgtcttccttccagagcccgaccaggcctccactggcatcaccg
acacactatgctccctccaaagccgcggcgctggcggcggccctgggacccgcggaagcc
ggcatgctggagaagctggagttcgaggacgaagcagtagaagactcagaaagtggtgtt
tacatgcgattcatgaggtcacacaagtgttatgacatcgttccaaccagttcaaagctt
gttgtctttgatactacattacaagttaaaaaggccttctttgctttggtagccaacggt
gtccgagcagcgccactgtgggagagtaaaaaacaaagttttgtaggaatgctaacaatt
acagatttcataaatatactacatagatactataaatcacctatggtacagatttatgaa
ttagaggaacataaaattgaaacatggagggagctttatttacaagaaacatttaagcct
ttagtgaatatatctccagatgcaagcctcttcgatgctgtatactccttgatcaaaaat
aaaatccacagattgcccgttattgaccctatcagtgggaatgcactttatatacttacc
cacaaaagaatcctcaagttcctccagctttttatgtctgatatgccaaagcctgccttc
atgaagcagaacctggatgagcttggaataggaacgtaccacaacattgccttcatacat
ccagacactcccatcatcaaagccttgaacatatttgtggaaagacgaatatcagctctg
cctgttgtggatgagtcaggaaaagttgtagatatttattccaaatttgatgtaattaat
cttgctgctgagaaaacatacaataacctagatatcacggtgacccaggcccttcagcac
cgttcacagtattttgaaggtgttgtgaagtgcaataagctggaaatactggagaccatc
gtggacagaatagtaagagctgaggtccatcggctggtggtggtaaatgaagcagatagt
attgtgggtattatttccctgtcggacattctgcaagccctgatcctcacaccagcaggt
gccaaacaaaaggagacagaaacggagtga

DBGET integrated database retrieval system