KEGG   Homo sapiens (human): 51426Help
Entry
51426             CDS       T01001                                 

Gene name
POLK, DINB1, DINP, POLQ
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06165  Epstein-Barr virus (EBV)
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00115  Mutation-inactivated TP53 to transcription
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00481  EBV BZLF1 to p53-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    51426 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    51426 (POLK)
   05202 Transcriptional misregulation in cancer
    51426 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    51426 (POLK)
   05212 Pancreatic cancer
    51426 (POLK)
   05225 Hepatocellular carcinoma
    51426 (POLK)
   05226 Gastric cancer
    51426 (POLK)
   05214 Glioma
    51426 (POLK)
   05216 Thyroid cancer
    51426 (POLK)
   05220 Chronic myeloid leukemia
    51426 (POLK)
   05217 Basal cell carcinoma
    51426 (POLK)
   05218 Melanoma
    51426 (POLK)
   05213 Endometrial cancer
    51426 (POLK)
   05224 Breast cancer
    51426 (POLK)
   05222 Small cell lung cancer
    51426 (POLK)
   05223 Non-small cell lung cancer
    51426 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    51426 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    51426 (POLK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     51426 (POLK)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    51426 (POLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone zf-C2H2_12
Motif
Other DBs
NCBI-GeneID: 51426
NCBI-ProteinID: NP_057302
OMIM: 605650
HGNC: 9183
Ensembl: ENSG00000122008
Vega: OTTHUMG00000102107
Pharos: Q9UBT6(Tbio)
UniProt: Q9UBT6 A0A024RAP4
Structure
PDB: 

Position
5q13.3
AA seq 870 aa AA seqDB search
MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKE
VKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNK
LSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVER
TFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQAL
SATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQSFQTSQPFQ
VLKKKMNENLEISENSDDCQILTCPVCFRAQGCISLEALNKHVDECLDGPSISENFKMFS
CSHVSATKVNKKENVPASSLCEKQDYEAHPKIKEISSVDCIALVDTIDNSSKAESIDALS
NKHSKEECSSLPSKSFNIEHCHQNSSSTVSLENEDVGSFRQEYRQPYLCEVKTGQALVCP
VCNVEQKTSDLTLFNVHVDVCLNKSFIQELRKDKFNPVNQPKESSRSTGSSSGVQKAVTR
TKRPGLMTKYSTSKKIKPNNPKHTLDIFFK
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggatagcacaaaggagaagtgtgacagttacaaagatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaacaaaattata
atggaagccacgaaggggtccagattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaatcaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcaatggaattagaacaaagccgaaatttgagc
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgctgtctacttcaaat
taccatgcaaggagatttggtgttcgtgcagccatgccaggatttattgctaagaggctg
tgcccacaacttataatagtgccccccaactttgacaaataccgagctgtgagtaaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttagaagaaagacaaaattggcctgaggataaaagaagg
tatttcatcaaaatgggaagctctgtagaaaatgataatccaggaaaggaagttaataaa
ctgagtgagcatgaacgatccatctctccactactttttgaagagagtccttctgatgtg
cagcccccaggagatcctttccaagtgaactttgaagaacaaaacaatcctcaaatactc
caaaactcagttgtttttggaacatcagcccaggaagtggtaaaggaaattcgtttcaga
attgagcagaaaacaacactgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattcttcccaatagacaa
gctgtgatggacttcatcaaggatttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcccttggaattattacatgtacagaactttaccaacagagg
gcattgctttctctccttttctctgaaacatcttggcattatttccttcatatctccttg
ggtctaggttcaacacacctgacgagggatggagagaggaaaagtatgagcgttgagagg
acattcagtgagataaataaagcggaagagcaatacagcctatgtcaagaactttgcagt
gagcttgctcaggatctacagaaagaaagacttaagggtagaactgttaccattaagttg
aagaatgtgaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctact
gcagaagaaatatttgccattgctaaggaattgctaaaaacagaaattgatgctgatttt
ccacatcccttgagattaaggcttatgggtgttcggatatctagttttcccaatgaagag
gacaggaaacaccaacaaaggagcattattggctttttacaggctggaaaccaagccctg
tcagccactgagtgtacattagagaaaactgacaaagataagtttgtaaaacctctagaa
atgtctcataagaagagtttctttgataaaaaacgatcagaaaggaaatggagtcaccaa
gatacatttaaatgtgaagccgtgaataaacaaagtttccagacatcacaaccattccaa
gttttaaagaagaagatgaatgagaatttggaaatatcagagaattcagatgactgtcag
atacttacctgtcctgtttgctttagggctcaagggtgcatcagtctggaagccttgaat
aaacatgtagatgaatgtcttgatggaccttcaatcagtgaaaactttaaaatgttctcg
tgttcacatgtttctgctaccaaagttaacaagaaagaaaatgttcctgcttcttcactt
tgtgagaagcaagattatgaagcccatccaaaaattaaagaaatatcttcagtagattgt
atagctttagtagatactatagataactcatctaaagcagaaagcatagatgctttaagt
aataagcatagcaaggaagaatgttctagtctcccaagcaagtcttttaatattgaacac
tgtcatcagaattcttcttctactgtttcattggaaaacgaagatgttggatcatttaga
caagaataccgccagccttacttatgtgaagtgaaaacaggccaagctctagtttgtcct
gtttgtaacgtagaacaaaagacttcagatctaaccctgttcaatgtgcatgtggatgtt
tgcttaaataaaagttttatccaagaattaagaaaggataaatttaacccagttaatcaa
cccaaagaaagctccagaagtactggtagctcaagtggagtacagaaggctgtaacaaga
acaaaaaggccaggattgatgacaaagtactcaacatcaaagaaaataaaaccaaacaat
cccaaacatacccttgatatattttttaagtaa

DBGET integrated database retrieval system