KEGG   Homo sapiens (human): 51428Help
Entry
51428             CDS       T01001                                 

Gene name
DDX41, ABS, MPLPF
Definition
(RefSeq) DEAD-box helicase 41
  KO
K13116  ATP-dependent RNA helicase DDX41 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    51428 (DDX41)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     51428 (DDX41)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    51428 (DDX41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C zf-CCHC ResIII SecA_DEAD UTP25 ERCC3_RAD25_C CMS1
Motif
Other DBs
NCBI-GeneID: 51428
NCBI-ProteinID: NP_057306
OMIM: 608170
HGNC: 18674
Ensembl: ENSG00000183258
Vega: OTTHUMG00000130858
Pharos: Q9UJV9(Tbio)
UniProt: Q9UJV9
Structure
PDB: 

Position
5q35.3
AA seq 622 aa AA seqDB search
MEESEPERKRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAE
EEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESV
AEGRALMSVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPI
KSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVI
MFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGG
MSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRT
IFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAK
MVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFRE
GKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKAC
DESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEA
MQTKQVSNIGRKDYLAHSSMDF
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtcggaacccgaacggaagcgggctcgcaccgacgaggtgcctgccggagga
agccgctccgaggcggaagatgaggacgacgaggactacgtgccctatgtgccgttacgg
cagcgccggcagctactgctccagaagctgctgcagcgaagacgcaagggagctgcggag
gaagagcagcaggacagcggtagtgaaccccggggagatgaggacgacatcccgctaggc
cctcagtccaacgtcagcctcctggatcagcaccagcaccttaaagagaaggctgaagcg
cgcaaagagtctgccaaggagaagcagctgaaggaagaagagaagatcctggagagtgtt
gccgagggccgagcattgatgtcagtgaaggagatggctaagggcattacgtatgatgac
cccatcaaaaccagctggactccaccccgttatgttctgagcatgtctgaagagcgacat
gagcgcgtgcggaagaaataccacatcctggtggagggagacggtatcccaccacccatc
aagagcttcaaggaaatgaagtttcctgcagccatcctgagaggcctgaagaagaaaggc
attcaccacccaacacccattcagatccagggcatccccaccattctatctggccgtgac
atgataggcatcgctttcacgggttcaggcaagacactggtgttcacgttgcccgtcatc
atgttctgcctggaacaagagaagaggttacccttctcaaagcgcgaggggccctatgga
ctcatcatctgcccctcgcgggagctggcccggcagacccatggcatcctggagtactac
tgccgcctgctgcaggaggacagctcaccactcctgcgctgcgccctctgcattgggggc
atgtccgtgaaagagcagatggagaccatccgacacggtgtacacatgatggtggccacc
ccggggcgcctcatggatttgctgcagaagaagatggtcagcctagacatctgtcgctac
ctggccctggacgaggctgaccgcatgatcgacatgggcttcgagggtgacatccgtacc
atcttctcctacttcaagggccagcgacagaccctgctcttcagtgccaccatgccgaag
aagattcagaactttgctaagagtgcccttgtaaagcctgtgaccatcaatgtggggcgc
gctggggctgccagcctggatgtcatccaggaggtagaatatgtgaaggaggaggccaag
atggtgtacctgctcgagtgcctgcagaagacacccccgcctgtactcatctttgcagag
aagaaggcagacgtggacgccatccacgagtacctgctgctcaagggggttgaggccgta
gccatccatgggggcaaagaccaggaggaacggactaaggccatcgaggcattccgggag
ggcaagaaggatgtcctagtagccacagacgttgcctccaagggcctggacttccctgcc
atccagcacgtcatcaattatgacatgccagaggagattgagaactatgtacaccggatt
ggccgcaccgggcgctcgggaaacacaggcatcgccactaccttcatcaacaaagcgtgt
gatgagtcagtgctgatggacctcaaagcgctgctgctagaagccaagcagaaggtgccg
cccgtgctgcaggtgctgcattgcggggatgagtccatgctggacattggaggagagcgc
ggctgtgccttctgcgggggcctgggtcatcggatcactgactgccccaaactcgaggct
atgcagaccaagcaggtcagcaacatcggtcgcaaggactacctggcccacagctccatg
gacttctga

DBGET integrated database retrieval system