KEGG   Homo sapiens (human): 51433
Entry
51433             CDS       T01001                                 

Gene name
ANAPC5, APC5
Definition
(RefSeq) anaphase promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04657  IL-17 signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51433 (ANAPC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51433 (ANAPC5)
   04114 Oocyte meiosis
    51433 (ANAPC5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    51433 (ANAPC5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51433 (ANAPC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51433 (ANAPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51433 (ANAPC5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51433 (ANAPC5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     51433 (ANAPC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    51433 (ANAPC5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_10 TPR_2 TPR_7 VP4_haemagglut TPR_19 MapZ_EC1
Other DBs
NCBI-GeneID: 51433
NCBI-ProteinID: NP_057321
OMIM: 606948
HGNC: 15713
Ensembl: ENSG00000089053
Vega: OTTHUMG00000169157
Pharos: Q9UJX4(Tbio)
UniProt: Q9UJX4
Structure
PDB: 

Position
12q24.31
AA seq 755 aa
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSR
DEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNS
IEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIA
LPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDK
GRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggccagcgtccacgagagcctctacttcaatcccatgatgaccaatggggttgtgcac
gccaatgtgttcggcatcaaggactgggtgacgccgtacaagatcgcggtgctggtgctg
ctgaacgagatgagccgcacaggcgagggcgccgtcagcctcatggagcggcggaggctc
aaccagctgctcctgcccctgctgcagggcccagatattacactgtcaaaactttacaag
ttaattgaagagtcttgtccacagctggcaaattcagtgcagatcagaatcaaactgatg
gctgaaggcgagttgaaggatatggaacagttttttgatgacctttcagattctttctct
ggaactgaaccagaggttcacaaaacaagtgtagtaggtttgtttctgcgtcacatgatc
ttggcctacagtaagctttctttcagccaagtgtttaaactgtacactgcccttcagcag
tacttccagaatggtgagaaaaagacagtggaggatgctgatatggaactgaccagtaga
gatgagggtgaaagaaaaatggaaaaagaagaacttgatgtatctgtaagagaagaggag
gtatcttgcagtgggcctctgtcccaaaaacaagcagaattttttctttctcaacaggct
tctttgctaaagaatgatgagactaaggccctcactccagcttccttgcagaaggaatta
aacaatttgttgaaatttaatcctgattttgctgaagcgcattatctcagctacttaaac
aacctccgtgtccaagatgttttcagttcaacacacagtctcctccattattttgatcgt
ctgattcttaccggagccgaaagcaaaagtaatggggaagagggctatggccggagcttg
agatacgccgctctgaatcttgccgccctgcactgccgcttcggtcactatcaacaggca
gagctcgccctgcaggaggcaattaggattgcccaggagtccaacgatcacgtgtgtctc
cagcactgtttgagctggctttatgtgctggggcagaagagatccgatagctatgttctg
ctggagcattctgtgaagaaggcagtacattttgggttaccgtacctcgcctccctggga
atacagtcccttgttcaacagagagcttttgctgggaagacggcaaacaagctgatggat
gccctaaaggactccgacctcctgcactggaaacacagcctgtcagagctcatcgatatc
agcatcgcacagaaaacggccatctggaggctgtatggccgcagcaccatggcactgcaa
caggcccagatgttgctgagcatgaacagcctggaggcggtgaatgcgggcgtgcagcag
aacaacacagagtcctttgctgtcgcactctgccacctcgcagagctacacgcggagcag
ggctgttttgctgcagcttctgaagtgttaaagcacttgaaggaacgatttccgcctaat
agtcagcacgcccagttatggatgctatgtgatcaaaaaatacagtttgacagagcaatg
aatgatggcaaatatcatttggctgattcacttgttacaggaatcacagctctcaatagc
atagagggtgtttataggaaagcggttgtattacaagctcagaaccaaatgtcagaggca
cataagcttttacaaaaattgttggttcattgtcagaaactgaagaacacagaaatggtg
atcagtgtcctactgtccgtggcagagctgtactggcgatcttcctcccctaccatcgcg
ctgcccatgctcctgcaggctctggccctctccaaggagtaccggttacagtacttggcc
tctgaaacagtgctgaacttggcttttgcgcagctcattcttggaatcccagaacaggcc
ttaagtcttctccacatggccatcgagcccatcttggctgacggggctatcctggacaaa
ggtcgtgccatgttcttagtggccaagtgccaggtggcttcagcagcttcctacgatcag
ccgaagaaagcagaagctctggaggctgccatcgagaacctcaatgaagccaagaactat
tttgcaaaggttgactgcaaagagcgcatcagggacgtcgtttacttccaggccagactc
taccataccctggggaagacccaggagaggaaccggtgtgcgatgctcttccggcagctg
catcaggagctgccctctcatggggtacccttgataaaccatctctag

DBGET integrated database retrieval system