KEGG   Homo sapiens (human): 51434
Entry
51434             CDS       T01001                                 
Symbol
ANAPC7, APC7, FERBON
Name
(RefSeq) anaphase promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle (cancer)
nt06512  Chromosome cohesion and segregation
nt06515  Regulation of kinetochore-microtubule interactions
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
N01486  Cohesin dissociation in anaphase
N01533  Disassembly of MCC
Disease
H02584  Ferguson-Bonni neurodevelopmental syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51434 (ANAPC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51434 (ANAPC7)
   04114 Oocyte meiosis
    51434 (ANAPC7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51434 (ANAPC7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51434 (ANAPC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51434 (ANAPC7)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51434 (ANAPC7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     51434 (ANAPC7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    51434 (ANAPC7)
SSDB
Motif
Pfam: TPR_2 TPR_19 TPR_14 TPR_8 ANAPC3 TPR_16 TPR_1 TPR_6 TPR_12 TPR_7 TPR_17 ChAPs TPR_21 BTAD TPR_10
Other DBs
NCBI-GeneID: 51434
NCBI-ProteinID: NP_001131136
OMIM: 606949
HGNC: 17380
Ensembl: ENSG00000196510
Position
12:complement(110372900..110403708)
AA seq 503 aa
MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYR
NAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKD
AIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSV
KGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLL
GSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNI
SDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAII
HFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLED
PVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRI
LGDFLVAVNEYQEAMDQYSIALR
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaatgtgatagaccacgtgcgggacatggcggccgcggggctgcactccaacgtgcgg
ctcctcagcagcttgttacttacaatgagtaataacaaccctgagttattctccccacct
cagaagtaccagcttttggtgtatcatgcagattctctctttcatgataaggaatatcgg
aatgctgtgagtaagtataccatggctttacagcagaagaaagcgctaagtaaaacttca
aaagtgagaccttcaactggaaattctgcatctactccacaaagtcagtgtcttccatct
gaaattgaagtgaaatacaaaatggctgaatgttatacaatgctaaaacaagataaagat
gccattgctatacttgatgggatcccttcaagacaaagaactcccaaaataaacatgatg
ctggcaaacctgtacaagaaggctggtcaggagcgcccttcagtcaccagctataaggag
gtgctgaggcagtgcccattagcccttgatgccattctaggcttgttgtccctttctgta
aaaggggcagaggtggcatccatgacaatgaatgtgatccaaaccgtgcctaacttggac
tggctctctgtgtggatcaaagcgtatgcttttgtgcacactggtgacaactcaagagca
atcagtaccatctgttcactagagaaaaaatccttattgcgagataacgtggacctattg
ggaagcttggcagatctgtacttcagagctggagacaataaaaactctgtcctcaagttt
gaacaggcacagatgttggatccttatctgataaaaggaatggatgtatatggctaccta
ctggcacgagaagggcggctagaggatgttgagaaccttggatgccgccttttcaatatc
tctgatcagcatgcagaaccgtgggtggtttctggctgtcacagcttctatagcaaacgc
tactcccgggccctctatttaggagccaaggccattcagctgaacagtaatagtgttcaa
gctctgctacttaagggagcagcacttaggaacatgggcagagtccaagaagcaataatc
cactttcgggaggccatacggctcgcaccttgtcgcttagattgttatgaaggtcttatc
gaatgttacttagcctccaacagtattcgagaagcaatggtaatggctaacaacgtttac
aaaactctgggagcaaatgcacagacccttacccttttagccaccgtttgtcttgaagac
ccagtgacacaggagaaagccaaaacattattagataaagccctgacccaaaggccagat
tacattaaggctgtggtgaaaaaagcagaactacttagcagagaacagaaatatgaagat
ggaattgctttgctgaggaacgcactggctaatcagagtgactgtgtcctgcatcggatc
ctaggagatttccttgtagctgtcaatgagtatcaggaggcaatggaccagtatagtata
gcactaaggtag

DBGET integrated database retrieval system