KEGG   Homo sapiens (human): 51434Help
Entry
51434             CDS       T01001                                 

Gene name
ANAPC7, APC7
Definition
(RefSeq) anaphase promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51434 (ANAPC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51434 (ANAPC7)
   04114 Oocyte meiosis
    51434 (ANAPC7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51434 (ANAPC7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51434 (ANAPC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51434 (ANAPC7)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51434 (ANAPC7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     51434 (ANAPC7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    51434 (ANAPC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_14 TPR_8 TPR_1 TPR_16 TPR_19 ANAPC3 TPR_7 TPR_11 TPR_12 ChAPs TPR_17 TPR_21 TPR_10 BTAD
Motif
Other DBs
NCBI-GeneID: 51434
NCBI-ProteinID: NP_057322
OMIM: 606949
HGNC: 17380
Ensembl: ENSG00000196510
Vega: OTTHUMG00000157009
Pharos: Q9UJX3(Tbio)
UniProt: Q9UJX3 Q4KMX6 A0A024RBJ3 Q69YV3
Structure
PDB: 

Position
12q24.11
AA seq 599 aa AA seqDB search
MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLL
LTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPST
GNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYK
KAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWI
KAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQML
DPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALY
LGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLAS
NSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVV
KKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDP
NDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggaccccggcgacgccgccattttggagtcttccctaaggatcctctaccggcttttc
gagtcagtgctgccgccgctgcccgcggctttgcagagcaggatgaatgtgatagaccac
gtgcgggacatggcggccgcggggctgcactccaacgtgcggctcctcagcagcttgtta
cttacaatgagtaataacaaccctgagttattctccccacctcagaagtaccagcttttg
gtgtatcatgcagattctctctttcatgataaggaatatcggaatgctgtgagtaagtat
accatggctttacagcagaagaaagcgctaagtaaaacttcaaaagtgagaccttcaact
ggaaattctgcatctactccacaaagtcagtgtcttccatctgaaattgaagtgaaatac
aaaatggctgaatgttatacaatgctaaaacaagataaagatgccattgctatacttgat
gggatcccttcaagacaaagaactcccaaaataaacatgatgctggcaaacctgtacaag
aaggctggtcaggagcgcccttcagtcaccagctataaggaggtgctgaggcagtgccca
ttagcccttgatgccattctaggcttgttgtccctttctgtaaaaggggcagaggtggca
tccatgacaatgaatgtgatccaaaccgtgcctaacttggactggctctctgtgtggatc
aaagcgtatgcttttgtgcacactggtgacaactcaagagcaatcagtaccatctgttca
ctagagaaaaaatccttattgcgagataacgtggacctattgggaagcttggcagatctg
tacttcagagctggagacaataaaaactctgtcctcaagtttgaacaggcacagatgttg
gatccttatctgataaaaggaatggatgtatatggctacctactggcacgagaagggcgg
ctagaggatgttgagaaccttggatgccgccttttcaatatctctgatcagcatgcagaa
ccgtgggtggtttctggctgtcacagcttctatagcaaacgctactcccgggccctctat
ttaggagccaaggccattcagctgaacagtaatagtgttcaagctctgctacttaaggga
gcagcacttaggaacatgggcagagtccaagaagcaataatccactttcgggaggccata
cggctcgcaccttgtcgcttagattgttatgaaggtcttatcgaatgttacttagcctcc
aacagtattcgagaagcaatggtaatggctaacaacgtttacaaaactctgggagcaaat
gcacagacccttacccttttagccaccgtttgtcttgaagacccagtgacacaggagaaa
gccaaaacattattagataaagccctgacccaaaggccagattacattaaggctgtggtg
aaaaaagcagaactacttagcagagaacagaaatatgaagatggaattgctttgctgagg
aacgcactggctaatcagagtgactgtgtcctgcatcggatcctaggagatttccttgta
gctgtcaatgagtatcaggaggcaatggaccagtatagtatagcactaagtttggacccc
aatgaccagaagtctctagaggggatgcagaagatggagaaggaggagagtcccacggat
gccactcaggaggaggatgtggacgacatggaagggagtggggaagaaggggacctggag
ggcagcgacagtgaggcggcccagtgggctgaccaggagcagtggttcggcatgcagtga

DBGET integrated database retrieval system