KEGG   Homo sapiens (human): 5144Help
Entry
5144              CDS       T01001                                 

Gene name
PDE4D, ACRDYS2, DPDE3, HSPDE4D, PDE43, PDE4DN2, STRK1
Definition
(RefSeq) phosphodiesterase 4D
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429
Apremilast: D08860
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Catramilast: D06575
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873
Diprophylline: D00691
Drotaverine (DG00044): D07088 D07879
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718 D07961
Ibudilast: D01385
Moxaverine (DG00045): D07089 D08238
Papaverine (DG00043): D02218 D07425 D07439
Piclamilast: D05474
Propentofylline: D01630
Proxyphylline: D01771
Roflumilast: D05744
Rolipram: D01783
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5144 (PDE4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5144 (PDE4D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5144 (PDE4D)
 09160 Human Diseases
  09164 Substance dependence
   05032 Morphine addiction
    5144 (PDE4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5144 (PDE4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I
Motif
Other DBs
NCBI-GeneID: 5144
NCBI-ProteinID: NP_001098101
OMIM: 600129
HGNC: 8783
Ensembl: ENSG00000113448
Vega: OTTHUMG00000162218
Pharos: Q08499(Tclin)
UniProt: Q08499 A0A140VJR0
Structure
PDB: 

Position
5q11.2-q12.1
AA seq 809 aa AA seqDB search
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagagggcagcagcgcgccggcccgggcgggcagcggagagggcagcgacagc
gccggcggggccacgctcaaagcccccaagcatctctggaggcacgagcagcaccaccag
tacccgctccggcagccccagttccgcctcctgcatccccatcaccacctgcccccgccg
ccgccaccctcgccccagccccagccccagtgtccgctacagccgccgccgccgcccccc
ctgccgccgcccccgccgccgcccggggctgcccgcggccgctacgcctcgagcggggcc
accggccgcgtccggcatcgcggctactcggacaccgagcgctacctgtactgtcgcgcc
atggaccgcacctcctacgcggtggagaccggccaccggcccggcctgaagaaatccagg
atgtcctggccctcctcgttccagggactcaggcgttttgatgtggacaatggcacatct
gcgggacggagtcccttggatcccatgaccagcccaggatccgggctaattctccaagca
aattttgtccacagtcaacgacgggagtccttcctgtatcgatccgacagcgattatgac
ctctctccaaagtctatgtcccggaactcctccattgccagtgatatacacggagatgac
ttgattgtgactccatttgctcaggtcttggccagtctgcgaactgtacgaaacaacttt
gctgcattaactaatttgcaagatcgagcacctagcaaaagatcacccatgtgcaaccaa
ccatccatcaacaaagccaccataacagaggaggcctaccagaaactggccagcgagacc
ctggaggagctggactggtgtctggaccagctagagaccctacagaccaggcactccgtc
agtgagatggcctccaacaagtttaaaaggatgcttaatcgggagctcacccatctctct
gaaatgagtcggtctggaaatcaagtgtcagagtttatatcaaacacattcttagataag
caacatgaagtggaaattccttctccaactcagaaggaaaaggagaaaaagaaaagacca
atgtctcagatcagtggagtcaagaaattgatgcacagctctagtctgactaattcaagt
atcccaaggtttggagttaaaactgaacaagaagatgtccttgccaaggaactagaagat
gtgaacaaatggggtcttcatgttttcagaatagcagagttgtctggtaaccggcccttg
actgttatcatgcacaccatttttcaggaacgggatttattaaaaacatttaaaattcca
gtagatactttaattacatatcttatgactctcgaagaccattaccatgctgatgtggcc
tatcacaacaatatccatgctgcagatgttgtccagtctactcatgtgctattatctaca
cctgctttggaggctgtgtttacagatttggagattcttgcagcaatttttgccagtgca
atacatgatgtagatcatcctggtgtgtccaatcaatttctgatcaatacaaactctgaa
cttgccttgatgtacaatgattcctcagtcttagagaaccatcatttggctgtgggcttt
aaattgcttcaggaagaaaactgtgacattttccagaatttgaccaaaaaacaaagacaa
tctttaaggaaaatggtcattgacatcgtacttgcaacagatatgtcaaaacacatgaat
ctactggctgatttgaagactatggttgaaactaagaaagtgacaagctctggagttctt
cttcttgataattattccgataggattcaggttcttcagaatatggtgcactgtgcagat
ctgagcaacccaacaaagcctctccagctgtaccgccagtggacggaccggataatggag
gagttcttccgccaaggagaccgagagagggaacgtggcatggagataagccccatgtgt
gacaagcacaatgcttccgtggaaaaatcacaggtgggcttcatagactatattgttcat
cccctctgggagacatgggcagacctcgtccaccctgacgcccaggatattttggacact
ttggaggacaatcgtgaatggtaccagagcacaatccctcagagcccctctcctgcacct
gatgacccagaggagggccggcagggtcaaactgagaaattccagtttgaactaacttta
gaggaagatggtgagtcagacacggaaaaggacagtggcagtcaagtggaagaagacact
agctgcagtgactccaagactctttgtactcaagactcagagtctactgaaattcccctt
gatgaacaggttgaagaggaggcagtaggggaagaagaggaaagccagcctgaagcctgt
gtcatagatgatcgttctcctgacacgtaa

DBGET integrated database retrieval system