KEGG   Homo sapiens (human): 51447Help
Entry
51447             CDS       T01001                                 

Gene name
IP6K2, IHPK2, InsP6K2, PIUS
Definition
(RefSeq) inositol hexakisphosphate kinase 2
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    51447 (IP6K2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     51447 (IP6K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 51447
NCBI-ProteinID: NP_001005909
OMIM: 606992
HGNC: 17313
Ensembl: ENSG00000068745
Vega: OTTHUMG00000133543
Pharos: Q9UHH9(Tbio)
UniProt: Q9UHH9 B2RCP4
Position
3p21.31
AA seq 426 aa AA seqDB search
MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMR
KFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHH
VLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWS
MKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQ
IRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLR
RELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAEDLEDLSEESA
DESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI
SEESGE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcccagccttcagggccatggatgtggagccccgcgccaaaggcgtccttctggag
ccctttgtccaccaggtcggggggcactcatgcgtgctccgcttcaatgagacaaccctg
tgcaagcccctggtcccaagggaacatcagttctacgagaccctccctgctgagatgcgc
aaattcactccccagtacaaaggtgtggtatctgtgcgctttgaagaagatgaagacagg
aacttgtgtctaatagcatatccattgaaaggggaccatggaattgtggacattgtagat
aattcagactgtgaaccaaaaagtaagctcctaaggtggacaacaaacaaaaaacatcat
gtcttagaaacagaaaagacccctaaggactgggtgcgtcagcaccgtaaagaggagaaa
atgaagagccataagttagaagaagaatttgagtggctaaagaaatctgaagtcttgtac
tacactgtagagaagaaggggaatataagttcccagcttaaacactataacccttggagc
atgaaatgtcaccagcaacagttacagagaatgaaggagaatgcaaagcatcggaaccag
tacaaatttatcttactggaaaacctgacttcccgctacgaggtgccttgtgtccttgac
ctcaagatgggcacacgacaacatggtgatgatgcttcagaggagaaggcagccaaccag
atccgaaaatgtcagcagagcacatctgcagtcattggtgtgcgtgtgtgtggcatgcag
gtgtaccaagcaggcagtgggcagctcatgttcatgaacaagtaccatggacggaagcta
tcggtgcagggcttcaaggaggcacttttccagttcttccacaatgggcggtacctgcgc
cgtgaactcctgggccctgtgctcaagaagctgactgagctcaaggcagtgttggagcga
caggagtcctaccgcttctactcaagctccctgctggtcatttatgatggcaaggagcgg
cccgaagtggtcctggactcagatgctgaggatttggaggacctgtcagaggaatcagct
gatgagtctgctggtgcctatgcctacaaacccatcggcgccagctctgtagatgtgcgc
atgatcgactttgcacacaccacctgcaggctgtatggcgaggacaccgtggtgcatgag
ggccaggatgctggctatatcttcgggctccagagcctgatagacattgtcacagagata
agtgaggagagtggggagtga

DBGET integrated database retrieval system