KEGG   Homo sapiens (human): 5145Help
Entry
5145              CDS       T01001                                 

Gene name
PDE6A, CGPR-A, PDEA, RP43
Definition
(RefSeq) phosphodiesterase 6A
  KO
K08718  rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha [EC:3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5145 (PDE6A)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    5145 (PDE6A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     5145 (PDE6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_3 SpoVT_C
Motif
Other DBs
NCBI-GeneID: 5145
NCBI-ProteinID: NP_000431
OMIM: 180071
HGNC: 8785
Ensembl: ENSG00000132915
Vega: OTTHUMG00000130047
Pharos: P16499(Tclin)
UniProt: P16499
Position
5q32
AA seq 860 aa AA seqDB search
MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEI
IFDLLRDFQENLQTEKCIFNVMKKLCFLLQADRMSLFMYRTRNGIAELATRLFNVHKDAV
LEDCLVMPDQEIVFPLDMGIVGHVAHSKKIANVPNTEEDEHFCDFVDILTEYKTKNILAS
PIMNGKDVVAIIMAVNKVDGSHFTKRDEEILLKYLNFANLIMKVYHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEVP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPAYVAQNGLICNIM
NAPAEDFFAFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
ECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQE
ALVRFMYSLSKGYRKITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSQVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYDAKMKVQEEKKQKQQSAKSAAAGN
QPGGNPSPGGATTSKSCCIQ
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggtgacagcagaggaggtggagaagttcctggactcgaatattggctttgcc
aaacagtactacaacctccactaccgggccaagctcatctccgacctccttggggccaag
gaggctgccgtggacttcagcaactaccactccccgagcagcatggaggagagcgaaatc
atctttgatctcctgcgggactttcaggagaatttacagacagagaaatgcatcttcaat
gtcatgaagaagctgtgcttcctcctgcaggcagaccgcatgagcctgttcatgtaccgg
acccgcaatggcatcgcagagctggccaccaggcttttcaatgtccacaaggatgctgtc
ctcgaggactgcctggtgatgcccgaccaagagatcgtcttccctttggacatgggcatc
gtgggccatgtcgcacactctaagaagattgctaacgtccccaacacagaggaggatgag
catttctgtgactttgtggacatcctcacagagtacaagaccaagaacatcttggcttcc
cccataatgaatgggaaggatgtggtggccataatcatggctgtgaataaagtggatgga
tcccacttcaccaagagagatgaagagattcttctcaagtacctcaattttgcaaatcta
atcatgaaggtgtaccacctgagttacctgcacaactgtgaaactcgacgtggccagata
ctgctgtggtctgggagcaaagtctttgaagaacttacggacatcgaacgacagttccac
aaagccctgtacacagtccgtgctttcctcaactgtgacagatactctgtgggtctctta
gacatgaccaagcagaaggaattttttgatgtgtggccggttctgatgggtgaagttcca
ccttactctggtcccaggactccggatggaagagaaattaacttttacaaggtcattgac
tacatcctgcatggcaaagaggacatcaaagtcatcccgaatccacctcctgaccattgg
gctttagtaagcggtctcccagcttatgttgcccagaatggcctgatttgcaacatcatg
aatgcgcctgcggaggacttttttgcatttcagaaagaacctctggatgagtctggatgg
atgattaaaaatgtgctttcaatgccgattgtgaacaagaaggaagaaattgttggagtg
gccacattttacaatcgtaaagatgggaagccctttgatgaaatggatgagacgctcatg
gagtctttgactcaatttctgggctggtctgtcttaaatcctgacacctatgagtcaatg
aataaacttgaaaataggaaggatattttccaggacatagtaaaatatcatgtgaagtgt
gacaatgaagaaattcagaaaatcttgaaaaccagagaggtgtatgggaaggagccatgg
gagtgtgaggaagaggagctggctgagatcctgcaagcggagctgccagatgcagataaa
tacgaaattaataaatttcacttcagtgacttacccctaacagaactggagctggtaaaa
tgtggaatacagatgtattatgagctcaaagtggtggataaatttcacattccacaagag
gccctggtgcggttcatgtactccctgagtaagggctaccgcaagatcacctaccacaac
tggcggcacggcttcaacgtggggcagaccatgttctccctgctggtgacgggaaagctg
aagcgctacttcacggacctagaggccttggccatggtcactgctgctttctgccatgac
attgaccacagaggcaccaataacctctaccagatgaaatcccagaacccactggccaag
ctccatgggtcctctatcttggaaagacaccacttggagtttggcaaaacactgctcaga
gacgagagcctgaatatctttcaaaacctcaatcgtcgacagcatgagcatgccatccac
atgatggacattgcaatcattgccacagacctcgccctgtatttcaagaagaggacgatg
ttccaaaagatcgtggatcagtctaagacatatgagagtgaacaggagtggacacagtac
atgatgctggagcagacacggaaggaaatcgttatggccatgatgatgaccgcctgtgat
ctctcagccatcaccaaaccctgggaggtgcagagccaggtagctctgctggtggctgct
gaattctgggaacaaggtgacctggagcgcacggtgctgcaacagaatcccattcccatg
atggacagaaacaaagcagatgaactccctaagcttcaagtcggcttcattgactttgtt
tgcaccttcgtctacaaggaattctcccgtttccacgaggagatcaccccaatgttggac
gggatcaccaacaatcgcaaggagtggaaggcgcttgctgatgagtacgatgccaagatg
aaggtgcaggaggagaagaagcagaaacagcagtcggccaagtcagcagccgcaggaaat
cagccggggggaaaccccagcccagggggtgcaactacatccaagtcctgctgcatccag
taa

DBGET integrated database retrieval system