KEGG   Homo sapiens (human): 51451
Entry
51451             CDS       T01001                                 

Gene name
LCMT1, CGI-68, LCMT, PPMT1
Definition
(RefSeq) leucine carboxyl methyltransferase 1
  KO
K18203  [phosphatase 2A protein]-leucine-carboxy methyltransferase [EC:2.1.1.233]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    51451 (LCMT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.233  [phosphatase 2A protein]-leucine-carboxy methyltransferase
     51451 (LCMT1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     51451 (LCMT1)
SSDB
Motif
Pfam: LCM
Other DBs
NCBI-GeneID: 51451
NCBI-ProteinID: NP_057393
OMIM: 610286
HGNC: 17557
Ensembl: ENSG00000205629
Vega: OTTHUMG00000177182
Pharos: Q9UIC8(Tbio)
UniProt: Q9UIC8
Structure
PDB: 
3IEI 3O7W 3P71

Position
16p12.1
AA seq 334 aa
MATRQRESSITSCCSTSSCDADDEGVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKE
RKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLPSKYFE
VDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEE
KLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQI
MIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESLE
FLDEMELLEQLMRHYCLCWATKGGNELGLKEITY
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggccactaggcagagggaatcctctatcacctcctgctgttccacctcgagctgcgac
gcagacgacgagggcgtgcgcggcacctgcgaagatgcttccctgtgcaagaggtttgca
gtaagcattggctactggcatgacccttacatacagcactttgtgagactgtctaaagag
aggaaagcccctgaaatcaacagaggatattttgctcgagtccatggtgtcagtcagctt
ataaaggcatttctacggaagacagaatgtcattgtcaaattgtcaaccttggggcaggc
atggataccaccttctggagattaaaggatgaagatcttctcccaagtaaatattttgag
gttgactttccaatgattgtcacgagaaagctgcacagtatcaaatgcaagcctccccta
tccagccccattctagaactgcattcagaggacacacttcagatggatggacacatactg
gattcaaagagatatgccgttattggagcagatctccgagacctgtctgaactggaagag
aagctaaagaaatgtaacatgaatacacaattgccaacactcctgatagctgaatgtgtg
ctggtttacatgactccagagcagtccgcaaacctcctgaagtgggcagccaacagtttt
gagagagccatgttcataaactacgaacaggtgaacatgggtgatcggtttgggcagatc
atgattgaaaacctgcggagacgccagtgtgacctggcgggagtggagacctgcaagtca
ttagagtcacagaaagaacggctcctgtcgaatgggtgggaaacagcatcggccgtcgac
atgatggagttgtacaacaggttacctcgagctgaagtgagcaggatagaatcacttgaa
ttcctggatgaaatggagctgctggagcagctcatgcggcattactgcctttgctgggca
accaaaggaggaaatgagcttgggctgaaggagataacttattaa

DBGET integrated database retrieval system