KEGG   Homo sapiens (human): 51454Help
Entry
51454             CDS       T01001                                 

Gene name
GULP1, CED-6, CED6, GULP
Definition
(RefSeq) GULP PTB domain containing engulfment adaptor 1
  KO
K23285  PTB domain-containing engulfment adapter protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51454 (GULP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Others
    51454 (GULP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID PTB PID_2 bZIP_2 Pox_A_type_inc DivIC Ax_dynein_light bZIP_1 KASH_CCD TSC22 HAP1_N DUF2004 ZapB Spc24 APG6_N Shugoshin_N Herpes_UL6 DUF4337 SlyX
Motif
Other DBs
NCBI-GeneID: 51454
NCBI-ProteinID: NP_057399
OMIM: 608165
HGNC: 18649
Ensembl: ENSG00000144366
Vega: OTTHUMG00000132647
Pharos: Q9UBP9(Tbio)
UniProt: Q9UBP9
Structure
PDB: 

Position
2q32.1-q32.2
AA seq 304 aa AA seqDB search
MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIK
KSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSES
NKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETEN
MELKNKVQDLENQLRITQVSAPPAGSMTPKSPSTDIFDMIPFSPISHQSSMPTRNGTQPP
PVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPL
DSRC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgcttttagcaggaagaaagacaaaacatggatgcatacacctgaagcttta
tcaaaacatttcattccctataatgcaaagtttcttggcagtacagaagtggaacagcca
aaaggaacagaagttgtgagagatgctgtaaggaaactaaagtttgcaagacatatcaag
aaatctgaaggccagaaaattcctaaagtggagttgcaaatatcaatttatggagtaaaa
attctagaacccaaaacaaaggaagttcaacacaattgccagcttcatagaatatctttt
tgtgcagatgataaaactgacaagaggatattcactttcatatgcaaagattctgagtca
aataaacatttgtgctatgtatttgacagcgaaaagtgtgctgaagagatcactttaaca
attggccaagcatttgacctggcatacaggaaatttctagaatcaggaggaaaagatgtt
gaaacaagaaaacagatcgcagggttacaaaaaagaatccaagacttagaaacagaaaat
atggaacttaaaaataaagtacaagatttggaaaaccaactgagaataactcaagtatca
gcacctccagcaggcagtatgacacctaagtcgccctccactgacatctttgatatgatt
ccattttctccaatatcacaccagtcttcgatgcctactcgcaatggcacacagccacct
ccagtacctagtagatctactgagattaaacgggacctgtttggagcagaaccttttgac
ccatttaactgtggagcagcagatttccctccagatattcaatcaaaattagatgagatg
caggaggggttcaaaatgggactaactcttgaaggcacagtattttgtctcgacccgtta
gacagtaggtgctga

DBGET integrated database retrieval system