KEGG   Homo sapiens (human): 51455Help
Entry
51455             CDS       T01001                                 

Gene name
REV1, AIBP80, REV1L
Definition
(RefSeq) REV1, DNA directed polymerase
  KO
K03515  DNA repair protein REV1 [EC:2.7.7.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    51455 (REV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    51455 (REV1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     51455 (REV1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    51455 (REV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS IMS_C REV1_C BRCT_2 UBM BRCT LIG3_BRCT PTCB-BRCT IMS_HHH Cdd1 mCpol DUF1805
Motif
Other DBs
NCBI-GeneID: 51455
NCBI-ProteinID: NP_057400
OMIM: 606134
HGNC: 14060
Ensembl: ENSG00000135945
Vega: OTTHUMG00000130636
Pharos: Q9UBZ9(Tbio)
UniProt: Q9UBZ9
Structure
PDB: 

Position
2q11.2
AA seq 1251 aa AA seqDB search
MRRGGWRKRAENDGWETWGGYMAAKVQKLEEQFRSDAAMQKDGTSSTIFSGVAIYVNGYT
DPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKA
GRLLSYIPYQLYTKQSSVQKGLSFNPVCRPEDPLPGPSNIAKQLNNRVNHIVKKIETENE
VKVNGMNSWNEEDENNDFSFVDLEQTSPGRKQNGIPHPRGSTAIFNGHTPSSNGALKTQD
CLVPMVNSVASRLSPAFSQEEDKAEKSSTDFRDCTLQQLQQSTRNTDALRNPHRTNSFSL
SPLHSNTKINGAHHSTVQGPSSTKSTSSVSTFSKAAPSVPSKPSDCNFISNFYSHSRLHH
ISMWKCELTEFVNTLQRQSNGIFPGREKLKKMKTGRSALVVTDTGDMSVLNSPRHQSCIM
HVDMDCFFVSVGIRNRPDLKGKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGKAA
DIPDSSLWENPDSAQANGIDSVLSRAEIASCSYEARQLGIKNGMFFGHAKQLCPNLQAVP
YDFHAYKEVAQTLYETLASYTHNIEAVSCDEALVDITEILAETKLTPDEFANAVRMEIKD
QTKCAASVGIGSNILLARMATRKAKPDGQYHLKPEEVDDFIRGQLVTNLPGVGHSMESKL
ASLGIKTCGDLQYMTMAKLQKEFGPKTGQMLYRFCRGLDDRPVRTEKERKSVSAEINYGI
RFTQPKEAEAFLLSLSEEIQRRLEATGMKGKRLTLKIMVRKPGAPVETAKFGGHGICDNI
ARTVTLDQATDNAKIIGKAMLNMFHTMKLNISDMRGVGIHVNQLVPTNLNPSTCPSRPSV
QSSHFPSGSYSVRDVFQVQKAKKSTEEEHKEVFRAAVDLEISSASRTCTFLPPFPAHLPT
SPDTNKAESSGKWNGLHTPVSVQSRLNLSIEVPSPSQLDQSVLEALPPDLREQVEQVCAV
QQAESHGDKKKEPVNGCNTGILPQPVGTVLLQIPEPQESNSDAGINLIALPAFSQVDPEV
FAALPAELQRELKAAYDQRQRQGENSTHQQSASASVPKNPLLHLKAAVKEKKRNKKKKTI
GSPKRIQSPLNNKLLNSPAKTLPGACGSPQKLIDGFLKHEGPPAEKPLEELSASTSGVPG
LSSLQSDPAGCVRPPAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEE
KDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
NT seq 3756 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaggtggatggaggaagcgagctgaaaatgatggctgggaaacatggggtggg
tatatggctgccaaggtccagaaattggaggaacagtttcgatcagatgctgctatgcag
aaggatgggacttcatctacaatttttagtggagttgccatctatgttaatggatacaca
gatccttccgctgaggaattgagaaaactaatgatgttgcatggaggtcaataccatgta
tattattccagatctaaaacaacacatattattgccacaaatcttcccaatgccaaaatt
aaagaattaaagggggaaaaagtaattcgaccagaatggattgtggaaagcatcaaagct
ggacgactcctctcctacattccatatcagctgtacaccaagcagtccagtgtgcagaaa
ggtctcagctttaatcctgtatgcagacctgaggatcctctgccaggtccaagcaatata
gccaaacagctcaacaacagggtaaatcacatcgttaagaagattgaaacggaaaatgaa
gtcaaagtcaatggcatgaacagttggaatgaagaagatgaaaataatgattttagtttt
gtggatctggagcagacctctccgggaaggaaacagaatggaattccgcatcccagaggg
agcactgccatttttaatggacacactcctagctctaatggtgccttaaagacacaggat
tgcttggtgcccatggtcaacagtgttgccagcaggctttctccagccttttcccaggag
gaggataaggctgagaagagcagcactgatttcagagactgcactctgcagcagttgcag
caaagcaccagaaacacagatgctttgcggaatccacacagaactaattctttctcatta
tcacctttgcacagtaacactaaaatcaatggtgctcaccactccactgttcaggggcct
tcaagcacaaaaagcacttcttcagtatctacgtttagcaaggcagcaccttcagtgcca
tccaaaccttcagactgcaattttatttcaaacttctattctcattcaagactgcatcac
atatcaatgtggaagtgtgaattgactgagtttgtcaataccctacaaagacaaagtaat
ggtatctttccaggaagggaaaagttaaaaaaaatgaaaacaggcaggtctgcacttgtt
gtaactgacacaggagatatgtcagtattgaattctcccagacatcagagctgtataatg
catgttgatatggattgcttctttgtatcagtgggtatacgaaatagaccagatctcaaa
ggaaaaccagtggctgttacaagtaacagaggcacaggaagggcacctttacgtcctggc
gctaacccccagctggagtggcagtattaccagaataaaatcctgaaaggcaaagcagca
gatataccagattcatcattgtgggagaatccagattctgcgcaagcaaatggaattgat
tctgttttgtcaagggctgaaattgcatcttgtagttatgaggccaggcaacttggcatt
aagaacggaatgttttttgggcatgctaaacaactatgtcctaatcttcaagctgttcca
tacgattttcatgcatataaggaagtcgcacaaacattgtatgaaacattggcaagctac
actcataacattgaagctgtcagttgtgatgaagcgctggtagacattaccgaaatcctt
gcagagaccaaacttactcctgatgaatttgcaaatgctgttcgtatggaaatcaaagac
cagacgaaatgtgctgcctctgttggaattggttctaatattctcctggctagaatggca
actagaaaagcaaaaccagatgggcagtaccacctaaaaccagaagaagtagatgatttt
atcagaggccagctagtgaccaatctaccaggagttggacattcaatggaatctaagttg
gcatctttgggaattaaaacttgtggagacttgcagtatatgaccatggcaaaactccaa
aaagaatttggtcccaaaacaggtcagatgctttataggttctgccgtggcttggatgat
agaccagttcgaactgaaaaggaaagaaaatctgtttcagctgagatcaactatggaata
aggtttactcagccaaaagaggcagaagcttttcttctgagtctttcagaagaaattcaa
agaagactagaagccactggcatgaagggtaaacgtctaactctcaaaatcatggtacga
aagcctggggctcctgtagaaactgcaaaatttggaggccatggaatttgtgataacatt
gccaggactgtaactcttgaccaggcaacagataatgcaaaaataattggaaaggcgatg
ctaaacatgtttcatacaatgaaactaaatatatcagatatgagaggggttgggattcac
gtgaatcagttggttccaactaatctgaacccttccacatgtcccagtcgcccatcagtt
cagtcaagccactttcctagtgggtcatactctgtccgtgatgtcttccaagttcagaaa
gctaagaaatccaccgaagaggagcacaaagaagtatttcgggctgctgtggatctggaa
atatcatctgcttctagaacttgcactttcttgccaccttttcctgcacatctgccgacc
agtcctgatactaacaaggctgagtcttcagggaaatggaatggtctacatactcctgtc
agtgtgcagtcgagacttaacctgagtatagaggtcccgtcaccttcccagctggatcag
tctgttttagaagcacttccacctgatctccgggaacaagtagagcaagtctgtgctgtc
cagcaagcagagtcacatggcgacaaaaagaaagaaccagtaaatggctgtaatacagga
attttgccacaaccagttgggacagtcttgttgcaaataccagaacctcaagaatcgaac
agtgacgcaggaataaatttaatagcccttccagcattttcacaggtggaccctgaggta
tttgctgcccttcctgctgaacttcagagggagctgaaagcagcgtatgatcaaagacaa
aggcagggcgagaacagcactcaccagcagtcagccagcgcatctgtgccaaagaatcct
ttacttcatctaaaggcagcagtgaaagaaaagaaaagaaacaagaagaaaaaaaccatt
ggttcaccaaaaaggattcagagtcctttgaataacaagctgcttaacagtcctgcaaaa
actctgccaggggcctgtggcagtccccagaagttaattgatgggtttctaaaacatgaa
ggacctcctgcagagaaacccctggaagaactctctgcttctacttcaggtgtgccaggc
ctttctagtttgcagtctgacccagctggctgtgtgagacctccagcacccaatctagct
ggagctgttgaattcaatgatgtgaagaccttgctcagagaatggataactacaatttca
gatccaatggaagaagacattctccaagttgtgaaatactgtactgatctaatagaagaa
aaagatttggaaaaactggatctagttataaaatacatgaaaaggctgatgcagcaatcg
gtggaatcggtttggaatatggcatttgactttattcttgacaatgtccaggtggtttta
caacaaacttatggaagcacattaaaagttacataa

DBGET integrated database retrieval system