KEGG   Homo sapiens (human): 51458Help
Entry
51458             CDS       T01001                                 

Gene name
RHCG, C15orf6, PDRC2, RHGK, SLC42A3
Definition
(RefSeq) Rh family C glycoprotein
  KO
K06580  ammonium transporter Rh
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    51458 (RHCG)
   04090 CD molecules [BR:hsa04090]
    51458 (RHCG)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC42: Rh ammonium transporter
   51458 (RHCG)
CD molecules [BR:hsa04090]
 Proteins
  51458 (RHCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp NiFe_hyd_3_EhaA
Motif
Other DBs
NCBI-GeneID: 51458
NCBI-ProteinID: NP_001307970
OMIM: 605381
HGNC: 18140
Ensembl: ENSG00000140519
Vega: OTTHUMG00000149647
Pharos: Q9UBD6(Tbio)
UniProt: Q9UBD6
Structure
PDB: 

Position
15q26.1
AA seq 479 aa AA seqDB search
MAWNTNLRWRLPLTCLLLQVIMVILFGVFVRYDFEADAHWWSERTHKNLSDMENEFYYRY
PSFQDVHVMVFVGFGFLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHFLQDRYIVV
GVENLINADFCVASVCVAFGAVLGKVSPIQLLIMTFFQVTLFAVNEFILLNLLKVKDAGG
SMTIHTFGAYFGLTVTRILYRRNLEQSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAIS
YHGDSQHRAAINTYCSLAACVLTSVAISSALHKKGKLDMVHIQNATLAGGVAVGTAAEMM
LMPYGALIIGFVCGIISTLGFVYLTPFLESRLHIQDTCGINNLHGIPGIIGGIVGAVTAA
SASLEVYGKEGLVHSFDFQGFNGDWTARTQGKFQIYGLLVTLAMALMGGIIVGLILRLPF
WGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaacaccaacctccgctggcggctgccgctcacctgcctgctcctgcaggtg
attatggtgattctcttcggggtgttcgtgcgctacgacttcgaggccgacgcccactgg
tggtcagagaggacgcacaagaacttgagcgacatggagaacgaattctactatcgctac
ccaagcttccaggacgtgcacgtgatggtcttcgtgggcttcggcttcctcatgactttc
ctgcagcgctacggcttcagcgccgtgggcttcaacttcctgttggcagccttcggcatc
cagtgggcgctgctcatgcagggctggttccacttcttacaagaccgctacatcgtcgtg
ggcgtggagaacctcatcaacgctgacttctgcgtggcctctgtctgcgtggcctttggg
gcagttctgggtaaagtcagccccattcagctgctcatcatgactttcttccaagtgacc
ctcttcgctgtgaatgagttcattctccttaacctgctaaaggtgaaggatgcaggaggc
tccatgaccatccacacatttggcgcctactttgggctcacagtgacccggatcctctac
cgacgcaacctagagcagagcaaggagagacagaattctgtgtaccagtcggacctcttt
gccatgattggcaccctcttcctgtggatgtactggcccagcttcaactcagccatatcc
taccatggggacagccagcaccgagccgccatcaacacctactgctccttggcagcctgc
gtgcttacctcggtggcaatatccagtgccctgcacaagaagggcaagctggacatggtg
cacatccagaatgccacgctcgcaggaggggtggccgtgggtaccgctgctgagatgatg
ctcatgccttacggtgccctcatcatcggcttcgtctgcggcatcatctccaccctgggt
tttgtatacctgaccccattcctggagtcccggctgcacatccaggacacatgtggcatt
aacaatctgcatggcattcctggcatcataggcggcatcgtgggtgctgtgacagcggcc
tccgccagccttgaagtctatggaaaagaagggcttgtccattcctttgactttcaaggt
ttcaacggggactggaccgcaagaacacagggaaagttccagatttatggtctcttggtg
accctggccatggccctgatgggtggcatcattgtggggctcattttgagattaccattc
tggggacaaccttcagatgagaactgctttgaggatgcggtctactgggagatgcctgaa
gggaacagcactgtctacatccctgaggaccccaccttcaagccctcaggaccctcagta
ccctcagtacccatggtgtccccactacccatggcttcctcggtacccttggtaccctag

DBGET integrated database retrieval system