KEGG   Homo sapiens (human): 51460Help
Entry
51460             CDS       T01001                                 

Gene name
SFMBT1, RU1, SFMBT, hSFMBT
Definition
(RefSeq) Scm like with four mbt domains 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MBT SLED SAM_1 SAM_2 SAM_PNT SAM_Ste50p TIMELESS_C XRCC4
Motif
Other DBs
NCBI-GeneID: 51460
NCBI-ProteinID: NP_057413
OMIM: 607319
HGNC: 20255
Ensembl: ENSG00000163935
Vega: OTTHUMG00000159052
Pharos: Q9UHJ3(Tbio)
UniProt: Q9UHJ3 A0A024R338
Position
3p21.1
AA seq 866 aa AA seqDB search
MNGEQQLDADAGSGMEEVELSWEDYLEETGSTAVPYGSFKHVDTRLQNGFAPGMKLEVAV
RTDPETYWVATVITTCEQLLLLRYDGYGEDRRADFWCDIRKADLYPIGWCEQNKKTLEAP
EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTW
IVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRHLKN
EAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMKLEAVDPWSPFGISPATVVKV
FDEKYFLVEMDDLRPENHARRSFVCHADSPGIFPVQWSLKNGLHISPPPGYPSQDFDWAD
YLKQCGAEAAPQRCFPPLISEHEFKENMKLEAVNPILPEEVCVATITAVRGSYLWLQLEG
SKKPIPECIVSVESMDIFPLGWCETNGHPLSTPRRARVYKQRKIAVVQPEKQVPSSRTVH
EGLRNQELNSTESVMINGKYCCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVLRE
VLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKGKSYRATVEIVKTADRVTEFC
RQTCIKLECCPNLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLACA
LKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGSGGEDEDDPDEGDDDSLSEGSTSE
QQDELQEESEMSEKKSCSSSPTQSEISTSLPPDRQRRKRELRTFSFSDDENKPPSPKEIR
IEVAERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMD
LKLGPAIKLCHHIERIKFAFYEQFAN
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggagcagcagcttgatgcagatgccggctctggtatggaagaggtagaatta
agctgggaagattatctagaagaaacagggtccacagcagttccctatgggtcttttaaa
catgtggacacacgtttgcaaaatggatttgctcctgggatgaagctggaggtggctgtg
agaacagatcctgagacctactgggttgccaccgttatcactacctgtgagcagttgctc
cttctccgctatgatggctatggggaggatcggagagcagatttctggtgtgacatcagg
aaggctgatctctaccccattgggtggtgtgagcagaataagaagacccttgaagcccca
gaaggcatcagagataaagtatctgactgggatgagtttctgcggcagaccctgatagga
gcatgtagtcctcctgttccgctgctagagggcctccgtaatgggaggaatcctttagat
ctcattgctccaggatccagactagaatgtcaagctttccaggactctttaagcacttgg
attgttactgtagtagaaaacattggaggaaggctgaagctacgttatgaaggacttgaa
agttctgacaattatgaacattggttgtattacttggatccatttcttcatcacgttggt
tgggctgctcaacagggatatgagcttcagcccccttcagccattagacatctaaaaaat
gaagctgagtggcaagagattttggccaaagtgaaagaggaagaggaagagccattacca
tcttacttatttaaggacaaacaagttattggcattcatacattctctgtaaacatgaaa
ttggaagctgtagacccctggtctccttttgggatctctcctgctacagttgttaaggtt
tttgatgagaagtactttctggtggaaatggatgacttgcgtcctgagaaccacgcacgg
cgatcctttgtgtgccacgccgacagtcctggcatcttccctgtgcagtggagtctgaag
aatggcctacacatcagcccccctccaggctacccaagccaggactttgactgggctgac
tacctcaaacagtgtggtgctgaagctgctccccagaggtgcttccctccgttaatttct
gaacatgaatttaaggagaacatgaagctcgaggcggtgaaccccattctccctgaagaa
gtgtgtgttgctaccatcactgcagtgagaggctcctacctgtggctccagctggagggt
tctaagaagcctatacctgaatgtattgtgagtgtggaatccatggatatatttcctttg
ggctggtgtgaaaccaacggccaccccctcagcactcctcgccgagcacgagtatataaa
cagaggaaaattgcagtggttcagccagaaaaacaagtaccatcctcgaggactgtccac
gagggcctgaggaatcaggagctgaactccacagagtcagttatgattaatggaaaatat
tgctgtccaaagatatacttcaaccaccgttgcttctcagggccatatcttaacaaagga
agaattgctgagctgcctcaatgtgtaggacctgggaactgtgttctggtccttagagag
gtcctcactttacttatcaatgcagcctacaaacccagccgtgtccttcgggagctccag
ctggacaaagactctgtgtggcacggatgtggggaagtcctaaaagccaaatataaagga
aagagttatcgggctactgttgagatagtgaaaacagcagatcgggtgactgaattctgc
cggcaaacctgtatcaaactggaatgctgtcctaacctcttcggtccacggatggttctg
gataagtgttctgagaactgttctgtacttacaaagaccaaatacacacactattacgga
aagaagaaaaataaaagaattgggaggccacctggtgggcatagtaacttagcttgtgcc
ctgaaaaaagccagtaagaggagaaagaggcggaaaaatgtttttgttcataagaagaaa
cgctcctctgcatctgttgataataccccagcgggctctccccagggaagtgggggtgaa
gatgaggatgacccagatgaaggggatgatgattccctaagtgaaggcagtacatccgag
cagcaggatgagctacaggaagaatcagaaatgtcagaaaaaaagtcatgctcctcttct
cccacccaaagtgagatatccacatcgctgcctccagatagacaaaggagaaaaagggag
cttcgcaccttttcattttctgacgatgaaaataaacctccttcaccaaaggaaataagg
atcgaagttgctgaaaggcttcacctggacagtaaccccttgaagtggagtgtggcagac
gttgtgcggttcatcagatccactgactgtgctccattagcaagaatattcctagaccag
gaaattgatgggcaggccctgttgctccttacccttcccactgttcaagaatgcatggac
ttaaaattgggccctgccatcaaactttgccatcacatagagaggatcaagtttgctttt
tatgagcagtttgccaactga

DBGET integrated database retrieval system